HPA024386

Anti-CD55 antibody produced in rabbit

Prestige Antibodies^® Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution

• Synonim(y): Anti-CD55 antigen, Anti-Complement decay-accelerating factor
• Numer MDL: MFCD00675552
• Kod UNSPSC: 12352203
• Numer w atlasie ludzkich białek: HPA024386
• NACRES: NA.43

Właściwości

• pochodzenie biologiczne: rabbit
• Poziom jakości: 100
• białko sprzężone: unconjugated
• forma przeciwciała: affinity isolated antibody
• rodzaj przeciwciała: primary antibodies
• klon: polyclonal
• linia produktu: Prestige Antibodies^® Powered by Atlas Antibodies
• Formularz: buffered aqueous glycerol solution
• reaktywność gatunkowa: human
• rozszerzona walidacja: orthogonal RNAseq; Learn more about Antibody Enhanced Validation
• metody: immunohistochemistry: 1:50- 1:200
• sekwencja immunogenna: PDVPNAQPALEGRTSFPEDTVITYKCEESFVKIPGEKDSVICLKGSQWSDIEEFCNRSCEVPTRLNSASLKQPYITQNYFPVGTVVEYECRPGYRREPSLSPKLTCLQNLKWSTAVEFCKKKSCPNPGEIRNGQIDVPGGILFGATISF
• numer dostępu UniProt: P08174
• Warunki transportu: wet ice
• temp. przechowywania: −20°C
• docelowa modyfikacja potranslacyjna: unmodified
• informacje o genach: human ... CD55(1604)

Opis

Opis ogólny

Decay accelerating factor (DAF)/complement decay-accelerating factor (CD55) is a cell associated C3 and C5 convertase regulator made of 4 tandem repeats (~60 amino acid long) known as short consensus repeats (SCRs) or complement control repeats (CCPs). It is a glycosylphosphatidylinositol (GPI)-anchored protein widely scattered among hematopoietic and nonhematopoietic cells. CD55 is located on human chromosome 1.

Immunogen

Complement decay-accelerating factor Precursor recombinant protein epitope signature tag (PrEST)

Zastosowanie

Anti-CD55 antibody has been used in immunohistochemistry and in the evaluation of the specificity of the anti-DAF (decay accelerating factor) antibody.

Applications in which this antibody has been used successfully, and the associated peer-reviewed papers, are given below.
Immunohistochemistry (1 paper)

Działania biochem./fizjol.

Decay accelerating factor (DAF)/complement decay-accelerating factor (CD55) regulates adaptive T cell responses. It serves as a receptor for the invasion of human RBCs by malaria parasites. It modulates the complement cascade on the cell surface. It also transfers the antigen determinants for the Cromer blood group system (CROM).

Cechy i korzyści

Prestige Antibodies^® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies^® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.

Every Prestige Antibody is tested in the following ways:

• IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
• Protein array of 364 human recombinant protein fragments.

Powiązanie

Corresponding Antigen APREST78248

Postać fizyczna

Solution in phosphate-buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide

Informacje prawne

Prestige Antibodies is a registered trademark of Merck KGaA, Darmstadt, Germany

Oświadczenie o zrzeczeniu się odpowiedzialności

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Ta strona może zawierać tekst przetłumaczony maszynowo.

Informacja o środkach bezpieczeństwa

• Kod klasy składowania: 10 - Combustible liquids
• Klasa zagrożenia wodnego (WGK): WGK 1
• Temperatura zapłonu (°F): Not applicable
• Temperatura zapłonu (°C): Not applicable