HPA014757
Anti-CYBRD1 antibody produced in rabbit
Prestige Antibodies® Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution
Synonim(y):
Anty-CYB561A2, Anty-DCYTB, Anty-FLJ23462, Anty-FRS3
Zaloguj sięWyświetlanie cen organizacyjnych i kontraktowych
About This Item
Polecane produkty
pochodzenie biologiczne
rabbit
Poziom jakości
białko sprzężone
unconjugated
forma przeciwciała
affinity isolated antibody
rodzaj przeciwciała
primary antibodies
klon
polyclonal
linia produktu
Prestige Antibodies® Powered by Atlas Antibodies
Formularz
buffered aqueous glycerol solution
reaktywność gatunkowa
human
rozszerzona walidacja
orthogonal RNAseq
Learn more about Antibody Enhanced Validation
metody
immunoblotting: 0.04-0.4 μg/mL
immunohistochemistry: 1:500-1:1000
sekwencja immunogenna
VTRPQWKRPKEPNSTILHPNGGTEQGARGSMPAYSGNNMDKSDSELNNEVAARKRNLALDEAGQRSTM
numer dostępu UniProt
Warunki transportu
wet ice
temp. przechowywania
−20°C
docelowa modyfikacja potranslacyjna
unmodified
informacje o genach
human ... CYBRD1(79901)
Opis ogólny
CYBRD1 (reduktaza cytochromu b 1) znajduje się głównie w enterocytach w ich błonie apikalnej i ulega wysokiej ekspresji w dwunastnicy. Jest to białko transmembranowe z sześcioma domenami transmembranowymi. Regiony transbłonowe zawierają cztery konserwowane reszty histydynowe, z dwiema domniemanymi cząsteczkami hemu. Posiada również miejsca wiążące askorbinian i monodehydroaskorbinian, obecne odpowiednio w miejscach przyjmujących elektrony i oddających elektrony. Jego masa cząsteczkowa wynosi 31,64 kDa.
Immunogen
Cytochrome b reductase 1 recombinant protein epitope signature tag (PrEST)
Zastosowanie
All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the industry.
The Human Protein Atlas project can be subdivided into three efforts: Human Tissue Atlas, Cancer Atlas, and Human Cell Atlas. The antibodies that have been generated in support of the Tissue and Cancer Atlas projects have been tested by immunohistochemistry against hundreds of normal and disease tissues and through the recent efforts of the Human Cell Atlas project, many have been characterized by immunofluorescence to map the human proteome not only at the tissue level but now at the subcellular level. These images and the collection of this vast data set can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. We also provide Prestige Antibodies® protocols and other useful information.
The Human Protein Atlas project can be subdivided into three efforts: Human Tissue Atlas, Cancer Atlas, and Human Cell Atlas. The antibodies that have been generated in support of the Tissue and Cancer Atlas projects have been tested by immunohistochemistry against hundreds of normal and disease tissues and through the recent efforts of the Human Cell Atlas project, many have been characterized by immunofluorescence to map the human proteome not only at the tissue level but now at the subcellular level. These images and the collection of this vast data set can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. We also provide Prestige Antibodies® protocols and other useful information.
Działania biochem./fizjol.
CYBRD1 (reduktaza cytochromu b 1) redukuje Fe3+ znajdujące się w żywności i dostarcza zredukowane żelazo do transportera metali dwuwartościowych-1 (DMT1). DMTI transportuje Fe2+ do enterocytów. Polimorfizm w tym genie jest związany z fenotypem żelaza w dziedzicznej hemochromatozie HFE. W erytrocytach może być odpowiedzialny za redukcję zewnątrzkomórkowego monodehydroaskorbinianu. Jest również zaangażowany w metabolizm miedzi i działa jako reduktaza miedziowa.
Cechy i korzyści
4357 to wysoce scharakteryzowane i wszechstronnie zwalidowane przeciwciała z dodatkową korzyścią w postaci wszystkich dostępnych danych dotyczących charakterystyki każdego celu, które są dostępne za pośrednictwem portalu Human Protein Atlas, do którego link znajduje się tuż pod nazwą produktu na górze tej strony. Wyjątkowość i niska reaktywność krzyżowa przeciwciał 4357 z innymi białkami wynika z dokładnego doboru regionów antygenowych, oczyszczania metodą powinowactwa i rygorystycznej selekcji. Kontrole antygenów Prestige są dostępne dla każdego odpowiedniego przeciwciała Prestige i można je znaleźć w sekcji powiązań.
Każde przeciwciało Prestige jest testowane w następujący sposób:
Każde przeciwciało Prestige jest testowane w następujący sposób:
- Macierz tkankowa IHC 44 normalnych tkanek ludzkich i 20 najczęściej występujących tkanek nowotworowych.
- Macierz białkowa 364 ludzkich rekombinowanych fragmentów białkowych.
Powiązanie
Odpowiadający antygen APREST73254
Postać fizyczna
Solution in phosphate-buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide
Informacje prawne
Prestige Antibodies is a registered trademark of Merck KGaA, Darmstadt, Germany
Oświadczenie o zrzeczeniu się odpowiedzialności
O ile nie określono inaczej w naszym katalogu lub innej dokumentacji firmy dołączonej do produktu(-ów), nasze produkty są przeznaczone wyłącznie do użytku badawczego i nie mogą być wykorzystywane do żadnych innych celów, w tym między innymi do nieautoryzowanych zastosowań komercyjnych, zastosowań diagnostycznych in vitro, zastosowań terapeutycznych ex vivo lub in vivo lub jakiegokolwiek rodzaju konsumpcji lub zastosowania u ludzi lub zwierząt.
Ta strona może zawierać tekst przetłumaczony maszynowo.
Nie możesz znaleźć właściwego produktu?
Wypróbuj nasz Narzędzie selektora produktów.
Kod klasy składowania
10 - Combustible liquids
Klasa zagrożenia wodnego (WGK)
WGK 1
Temperatura zapłonu (°F)
Not applicable
Temperatura zapłonu (°C)
Not applicable
Środki ochrony indywidualnej
Eyeshields, Gloves, multi-purpose combination respirator cartridge (US)
Wybierz jedną z najnowszych wersji:
Certyfikaty analizy (CoA)
Lot/Batch Number
Nie widzisz odpowiedniej wersji?
Jeśli potrzebujesz konkretnej wersji, możesz wyszukać konkretny certyfikat według numeru partii lub serii.
Masz już ten produkt?
Dokumenty związane z niedawno zakupionymi produktami zostały zamieszczone w Bibliotece dokumentów.
Sara Pelucchi et al.
Haematologica, 97(12), 1818-1825 (2012-07-10)
Most patients with hereditary hemochromatosis in the Caucasian population are homozygous for the p.C282Y mutation in the HFE gene. The penetrance and expression of hereditary hemochromatosis differ largely among cases of homozygous p.C282Y. Genetic factors might be involved in addition
Dan Su et al.
The Journal of biological chemistry, 281(52), 39852-39859 (2006-10-28)
Human erythrocytes contain an unidentified plasma membrane redox system that can reduce extracellular monodehydroascorbate by using intracellular ascorbate (Asc) as an electron donor. Here we show that human erythrocyte membranes contain a cytochrome b(561) (Cyt b(561)) and hypothesize that it
Gladys O Latunde-Dada et al.
The Journal of nutrition, 138(6), 991-995 (2008-05-22)
Duodenal cytochrome B (Dcytb) is localized principally in the apical membrane of the enterocyte. It is thought to act as a ferric reductase that furnishes Fe(II), the specific and selective iron species transported by divalent metal transporter 1 (DMT1) in
Steven Wyman et al.
FEBS letters, 582(13), 1901-1906 (2008-05-24)
MDCK cells expressing an inducible duodenal cytochrome b-green fluorescent protein (Dcytb-EGFP) fusion construct were used to investigate the function of Dcytb. The Dcytb-EGFP protein was targeted correctly to the plasma membrane, and cells displayed increased ferric and cupric reductase activities
Kamila Balusikova et al.
Journal of cellular and molecular medicine, 26(10), 2995-3004 (2022-04-22)
Duodenal biopsies are considered a suitable source of enterocytes for studies of dietary iron absorption. However, the expression level of molecules involved in iron absorption may vary along the length of duodenum. We aimed to determine whether the expression of
Nasz zespół naukowców ma doświadczenie we wszystkich obszarach badań, w tym w naukach przyrodniczych, materiałoznawstwie, syntezie chemicznej, chromatografii, analityce i wielu innych dziedzinach.
Skontaktuj się z zespołem ds. pomocy technicznej