HPA005714

Anti-FOXJ1 antibody produced in rabbit

Prestige Antibodies^® Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution

• Synonim(y): Przeciwciało FOXJ1 - przeciwciało anty-FOXJ1 produkowane u królików, Przeciwciało Foxj1
• Kod UNSPSC: 12352203
• Numer w atlasie ludzkich białek: HPA005714
• NACRES: NA.41

Właściwości

• pochodzenie biologiczne: rabbit
• białko sprzężone: unconjugated
• forma przeciwciała: affinity isolated antibody
• rodzaj przeciwciała: primary antibodies
• klon: polyclonal
• linia produktu: Prestige Antibodies^® Powered by Atlas Antibodies
• Formularz: buffered aqueous glycerol solution
• reaktywność gatunkowa: human
• rozszerzona walidacja: orthogonal RNAseq; Learn more about Antibody Enhanced Validation
• metody: immunohistochemistry: 1:500- 1:1000
• sekwencja immunogenna: PREKDEPGKGGFWRIDPQYAERLLSGAFKKRRLPPVHIHPAFARQAAQEPSAVPRAGPLTVNTEAQQLLREFEEATGEAGWGAGEGRLGHKRKQPLPKRVAKVPRPPSTLLPTPEEQGELEPLKG
• numer dostępu UniProt: Q92949
• Warunki transportu: wet ice
• temp. przechowywania: −20°C
• docelowa modyfikacja potranslacyjna: unmodified
• informacje o genach: human ... FOXJ1(2302)

Opis

Opis ogólny

Forkhead box protein J1 (FOXJ1) is a transcription factor which belongs to the forkhead-box (FOX) gene family. It contains a DNA-binding domain called the forkhead domain. The gene encoding the protein is present on chromosome 17q25.

Immunogen

Forkhead box protein J1 recombinant protein epitope signature tag (PrEST)

Zastosowanie

Anti-FOXJ1 antibody produced in rabbit, a Prestige Antibody, is developed and validated by the Human Protein Atlas (HPA) project . Each antibody is tested by immunohistochemistry against hundreds of normal and disease tissues. These images can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. The antibodies are also tested using immunofluorescence and western blotting. To view these protocols and other useful information about Prestige Antibodies and the HPA, visit sigma.com/prestige.

Applications in which this antibody has been used successfully, and the associated peer-reviewed papers, are given below.
Immunofluorescence (1 paper)

These images and the collection of this vast data set can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. We also provide Prestige Antibodies^® protocols and other useful information.

Działania biochem./fizjol.

Forkhead box protein J1 (FOXJ1) is a transcription factor that can suppress T cell activity, through the repression of NF-κβ activity. Its dysregulation is associated with autoimmune diseases and inflammatory diseases. FOXJ1 plays a critical role in the maintenance of immune homeostasis. This involves intricate interactions between the forkhead family members and inflammatory transcription factors. It coordinates the regulation of the activity of two key inflammatory transcription factors, NF-AT and NF-κβ. It has also been shown that FOXJ1 has fundamental roles in ciliogenesis in the lung and is directly required for epithelial cell ciliogenesis of the neonatal oviduct.

Cechy i korzyści

Prestige Antibodies^® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies^® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.

Every Prestige Antibody is tested in the following ways:

• IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
• Protein array of 364 human recombinant protein fragments.

Powiązanie

Corresponding Antigen APREST86948

Postać fizyczna

Solution in phosphate-buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide

Informacje prawne

Prestige Antibodies is a registered trademark of Merck KGaA, Darmstadt, Germany

Oświadczenie o zrzeczeniu się odpowiedzialności

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Ta strona może zawierać tekst przetłumaczony maszynowo.

Informacja o środkach bezpieczeństwa

• Kod klasy składowania: 10 - Combustible liquids
• Klasa zagrożenia wodnego (WGK): WGK 1
• Temperatura zapłonu (°F): Not applicable
• Temperatura zapłonu (°C): Not applicable
• Środki ochrony indywidualnej: Eyeshields, Gloves, multi-purpose combination respirator cartridge (US)