HPA004246

Anti-PRKAG2 antibody produced in rabbit

Prestige Antibodies^® Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution

• Synonim(y): Anti-5′-AMP-activated protein kinase subunit γ-2 antibody produced in rabbit, Anti-AMPK γ-2 chain antibody produced in rabbit, Anti-AMPK γ2 antibody produced in rabbit, Anti-H91620p antibody produced in rabbit
• Kod UNSPSC: 12352203
• Numer w atlasie ludzkich białek: HPA004246
• NACRES: NA.41

Właściwości

• pochodzenie biologiczne: rabbit
• białko sprzężone: unconjugated
• forma przeciwciała: affinity isolated antibody
• rodzaj przeciwciała: primary antibodies
• klon: polyclonal
• linia produktu: Prestige Antibodies^® Powered by Atlas Antibodies
• Postać: buffered aqueous glycerol solution
• reaktywność gatunkowa: rat, mouse, human
• metody: immunoblotting: 0.04-0.4 μg/mL; immunofluorescence: 0.25-2 μg/mL; immunohistochemistry: 1:50-1:200
• sekwencja immunogenna: STPTQVTKQHTFPLESYKHEPERLENRIYASSSPPDTGQRFCPSSFQSPTRPPLASPTHYAPSKAAALAAALGPAEAGMLEKLEFEDEAVEDSESGVYMRFMRSHK
• numer dostępu UniProt: Q9UGJ0
• Warunki transportu: wet ice
• temp. przechowywania: −20°C
• docelowa modyfikacja potranslacyjna: unmodified
• informacje o genach: human ... PRKAG2(51422)

Opis

Opis ogólny

PRKAG2 (protein kinase, AMP-activated, γ2 non-catalytic subunit) is a non-catalytic regulatory subunit of heterotrimeric AMP-activated protein kinase (AMPK), involved in the energy metabolism. It is predominantly present in all subcellular fractions, including the nuclei.

Immunogen

5′-AMP-activated protein kinase subunit γ-2 recombinant protein epitope signature tag (PrEST)

Zastosowanie

Anti-PRKAG2 antibody produced in rabbit, a Prestige Antibody, is developed and validated by the Human Protein Atlas (HPA) project . Each antibody is tested by immunohistochemistry against hundreds of normal and disease tissues. These images can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. The antibodies are also tested using immunofluorescence and western blotting. To view these protocols and other useful information about Prestige Antibodies and the HPA, visit sigma.com/prestige.

Działania biochem./fizjol.

PRKAG2 (protein kinase, AMP-activated, γ2 non-catalytic subunit) acts as a sensor of cellular energy status that is controlled by AMP (positively) and ATP (negatively). In normal state CBS domains from AMP-activated protein kinase can bind AMP, ATP, or S-adenosyl methionine. But in mutated condition, it cannot bind. As a result, it leads to hereditary diseases. Its major activity is involved in the regulation of energy homeostasis. It plays an important role in correcting of cell division and chromosome segregation during mitosis. Mutation in PRKAG2 causes Wolff-Parkinson-White (WPW) syndrome, a rare autosomal dominant inheritance disease.

Cechy i korzyści

Prestige Antibodies^® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies^® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.

Every Prestige Antibody is tested in the following ways:

• IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
• Protein array of 364 human recombinant protein fragments.

Powiązanie

Corresponding Antigen APREST86734

Postać fizyczna

Solution in phosphate-buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide

Informacje prawne

Prestige Antibodies is a registered trademark of Merck KGaA, Darmstadt, Germany

Oświadczenie o zrzeczeniu się odpowiedzialności

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

This page may contain text that has been machine translated.

Informacja o środkach bezpieczeństwa

• Kod klasy składowania: 10 - Combustible liquids
• Klasa zagrożenia wodnego (WGK): WGK 1
• Temperatura zapłonu (°F): Not applicable
• Temperatura zapłonu (°C): Not applicable
• Środki ochrony indywidualnej: Eyeshields, Gloves, multi-purpose combination respirator cartridge (US)