Przejdź do zawartości
Merck
Wszystkie zdjęcia(8)

Kluczowe dokumenty

HPA003575

Sigma-Aldrich

Anti-TRIM22 antibody produced in rabbit

enhanced validation

Ab2, Prestige Antibodies® Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution

Synonim(y):

Anti-50 kDa-stimulated trans-acting factor antibody produced in rabbit, Anti-RING finger protein 94 antibody produced in rabbit, Anti-Staf-50 antibody produced in rabbit, Anti-Tripartite motif-containing protein 22 antibody produced in rabbit

Zaloguj sięWyświetlanie cen organizacyjnych i kontraktowych


About This Item

Kod UNSPSC:
12352203
Numer w atlasie ludzkich białek:
NACRES:
NA.41

pochodzenie biologiczne

rabbit

Poziom jakości

białko sprzężone

unconjugated

forma przeciwciała

affinity isolated antibody

rodzaj przeciwciała

primary antibodies

klon

polyclonal

linia produktu

Prestige Antibodies® Powered by Atlas Antibodies

Formularz

buffered aqueous glycerol solution

reaktywność gatunkowa

human

rozszerzona walidacja

RNAi knockdown
Learn more about Antibody Enhanced Validation

metody

immunoblotting: 0.04-0.4 μg/mL
immunofluorescence: 0.25-2 μg/mL
immunohistochemistry: 1:500-1:1000

sekwencja immunogenna

NEVVKECQEKLQVALQRLIKEDQEAEKLEDDIRQERTAWKNYIQIERQKILKGFNEMRVILDNEEQRELQKLEEGEVNVLDNLAAATDQLVQQRQDASTLISDLQRRLRGSSVEMLQDVIDVMKRSESWTLKKPKSVSKKLKSVFRV

numer dostępu UniProt

Warunki transportu

wet ice

temp. przechowywania

−20°C

docelowa modyfikacja potranslacyjna

unmodified

informacje o genach

human ... TRIM22(10346)

Szukasz podobnych produktów? Odwiedź Przewodnik dotyczący porównywania produktów

Immunogen

Tripartite motif-containing protein 22 recombinant protein epitope signature tag (PrEST)

Zastosowanie

Applications in which this antibody has been used successfully, and the associated peer-reviewed papers, are given below.
Western Blotting (1 paper)

Działania biochem./fizjol.

Tripartite motif-containing 22 is a protein encoded by the TRIM22 gene in humans and belongs to tripartite motif (TRIM) protein superfamily. The members of this family are important effectors of the innate immune response against viral infections. It is an interferon (IFN)-inducible protein as well as a p53 target gene. It plays a role in viral defense by restricting viral replication and may function as a ubiquitin E3 ligase. This gene is found to exert antiviral activity against RNA viruses, such as hepatitis B virus (HBV), encephalomyocarditis virus (ECMV) and human immunodeficiency virus type 1 (HIV-1). It is involved in the activation of NF-κB. It acts as a positive regulator of NF-κB-mediated transcription.

Cechy i korzyści

Prestige Antibodies® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.

Every Prestige Antibody is tested in the following ways:
  • IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
  • Protein array of 364 human recombinant protein fragments.

Powiązanie

Corresponding Antigen APREST86655

Postać fizyczna

Solution in phosphate-buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide

Informacje prawne

Prestige Antibodies is a registered trademark of Merck KGaA, Darmstadt, Germany

Oświadczenie o zrzeczeniu się odpowiedzialności

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
Ta strona może zawierać tekst przetłumaczony maszynowo.

Nie możesz znaleźć właściwego produktu?  

Wypróbuj nasz Narzędzie selektora produktów.

Kod klasy składowania

10 - Combustible liquids

Klasa zagrożenia wodnego (WGK)

WGK 1

Temperatura zapłonu (°F)

Not applicable

Temperatura zapłonu (°C)

Not applicable

Środki ochrony indywidualnej

Eyeshields, Gloves, multi-purpose combination respirator cartridge (US)


Wybierz jedną z najnowszych wersji:

Certyfikaty analizy (CoA)

Lot/Batch Number

Nie widzisz odpowiedniej wersji?

Jeśli potrzebujesz konkretnej wersji, możesz wyszukać konkretny certyfikat według numeru partii lub serii.

Masz już ten produkt?

Dokumenty związane z niedawno zakupionymi produktami zostały zamieszczone w Bibliotece dokumentów.

Odwiedź Bibliotekę dokumentów

Ravesh Singh et al.
Journal of virology, 88(8), 4291-4303 (2014-01-31)
The antiviral role of TRIM E3 ligases in vivo is not fully understood. To test the hypothesis that TRIM5α and TRIM22 have differential transcriptional regulation and distinct anti-HIV roles according to infection phase and compartment, we measured TRIM5α, TRIM22, and
Hui Tian et al.
Yonsei medical journal, 59(4), 511-518 (2018-05-12)
Hepatitis C virus (HCV) infection is a major cause of liver disease. Several miRNAs have been found to be associated with HCV infection. This study aimed to investigate the functional roles and possible molecular mechanisms of miR-215 in HCV replication.
Filippo Turrini et al.
Virus research, 269, 197631-197631 (2019-05-29)
The human immunodeficiency virus type-1 (HIV-1) establishes a state of latent infection in a small number of CD4+ T lymphocytes that, nonetheless, represent a major obstacle to viral eradication. We here show that Tripartite Motif-containing protein 22 (TRIM22), an epigenetic
Jessica Petersson et al.
Experimental cell research, 316(4), 568-579 (2009-12-17)
TRIM22 (Staf50), a member of the TRIM protein family, is an interferon (IFN)-inducible protein as well as a p53 target gene. The function of TRIM22 is largely unknown, but TRIM22 is suggested to play a role in viral defense by
Shanshan Yu et al.
Biochemical and biophysical research communications, 410(2), 247-251 (2011-06-10)
Increasing evidence suggests that TRIM family proteins may play important roles in the regulation of innate immune signaling pathways. Here we report TRIM22 is involved in the activation of NF-κB. It was found that overexpression of TRIM22 could dose-dependently activate

Global Trade Item Number

SKUGTIN
HPA003575-25UL4061842720439
HPA003575-100UL4061837134784

Nasz zespół naukowców ma doświadczenie we wszystkich obszarach badań, w tym w naukach przyrodniczych, materiałoznawstwie, syntezie chemicznej, chromatografii, analityce i wielu innych dziedzinach.

Skontaktuj się z zespołem ds. pomocy technicznej