HPA002637
Anti-CDK6 antibody produced in rabbit
affinity isolated antibody, buffered aqueous glycerol solution
Synonim(y):
Anti-Cell division protein kinase 6, Anti-Serine/threonine- protein kinase PLSTIRE
Zaloguj sięWyświetlanie cen organizacyjnych i kontraktowych
About This Item
Polecane produkty
pochodzenie biologiczne
rabbit
Poziom jakości
białko sprzężone
unconjugated
forma przeciwciała
affinity isolated antibody
rodzaj przeciwciała
primary antibodies
klon
polyclonal
Formularz
buffered aqueous glycerol solution
reaktywność gatunkowa
human
rozszerzona walidacja
orthogonal RNAseq
RNAi knockdown
Learn more about Antibody Enhanced Validation
metody
immunoblotting: 0.04-0.4 μg/mL
immunofluorescence: 0.25-2 μg/mL
immunohistochemistry: 1:50-1:200
sekwencja immunogenna
FRGSSDVDQLGKILDVIGLPGEEDWPRDVALPRQAFHSKSAQPIEKFVTDIDELGKDLLLKCLTFNPAKRISAYSALSHPYFQDLERCKENLDSHLPPSQNTSELN
numer dostępu UniProt
Warunki transportu
wet ice
temp. przechowywania
−20°C
docelowa modyfikacja potranslacyjna
unmodified
informacje o genach
human ... CDK6(1021)
Powiązane kategorie
Opis ogólny
Kinaza zależna od cyklin 6 (CDK6) należy do rodziny kinaz białkowych zależnych od cyklin (CDK). Jest to małe białko z domeną katalityczną.
Immunogen
Cell division protein kinase 6 recombinant protein epitope signature tag (PrEST)
Zastosowanie
All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the industry.
The Human Protein Atlas project can be subdivided into three efforts: Human Tissue Atlas, Cancer Atlas, and Human Cell Atlas. The antibodies that have been generated in support of the Tissue and Cancer Atlas projects have been tested by immunohistochemistry against hundreds of normal and disease tissues and through the recent efforts of the Human Cell Atlas project, many have been characterized by immunofluorescence to map the human proteome not only at the tissue level but now at the subcellular level. These images and the collection of this vast data set can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. We also provide Prestige Antibodies® protocols and other useful information.
The Human Protein Atlas project can be subdivided into three efforts: Human Tissue Atlas, Cancer Atlas, and Human Cell Atlas. The antibodies that have been generated in support of the Tissue and Cancer Atlas projects have been tested by immunohistochemistry against hundreds of normal and disease tissues and through the recent efforts of the Human Cell Atlas project, many have been characterized by immunofluorescence to map the human proteome not only at the tissue level but now at the subcellular level. These images and the collection of this vast data set can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. We also provide Prestige Antibodies® protocols and other useful information.
Działania biochem./fizjol.
Kinaza zależna od cyklin 6 (CDK6) odgrywa ważną rolę w kontroli cyklu komórkowego. Wiąże się z cykliną D1, aby ułatwić przejście komórek przez fazę G1. Kontroluje również aktywność receptora estrogenowego i receptora androgenowego (AR) poprzez wiązanie się z nim. Hamuje receptor androgenowy (AR) i aktywuje aktywność transkrypcyjną receptora estrogenowego. W ludzkim raku prostaty stymuluje aktywność receptora androgenowego (AR), co wpływa na rozwój i/lub progresję komórek. Jego nadekspresję odnotowano w ludzkim raku piersi i jelita grubego.
Cechy i korzyści
4357 to wysoce scharakteryzowane i wszechstronnie zwalidowane przeciwciała z dodatkową korzyścią w postaci wszystkich dostępnych danych dotyczących charakterystyki każdego celu, które są dostępne za pośrednictwem portalu Human Protein Atlas, do którego link znajduje się tuż pod nazwą produktu na górze tej strony. Wyjątkowość i niska reaktywność krzyżowa przeciwciał 4357 z innymi białkami wynika z dokładnego doboru regionów antygenowych, oczyszczania metodą powinowactwa i rygorystycznej selekcji. Kontrole antygenów Prestige są dostępne dla każdego odpowiedniego przeciwciała Prestige i można je znaleźć w sekcji powiązań.
Każde przeciwciało Prestige jest testowane w następujący sposób:
Każde przeciwciało Prestige jest testowane w następujący sposób:
- Macierz tkankowa IHC 44 normalnych tkanek ludzkich i 20 najczęściej występujących tkanek nowotworowych.
- Macierz białkowa 364 ludzkich rekombinowanych fragmentów białkowych.
Powiązanie
Odpowiadający antygen APREST86426
Postać fizyczna
Solution in phosphate-buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide
Informacje prawne
Prestige Antibodies is a registered trademark of Merck KGaA, Darmstadt, Germany
Oświadczenie o zrzeczeniu się odpowiedzialności
O ile nie określono inaczej w naszym katalogu lub innej dokumentacji firmy dołączonej do produktu(-ów), nasze produkty są przeznaczone wyłącznie do użytku badawczego i nie mogą być wykorzystywane do żadnych innych celów, w tym między innymi do nieautoryzowanych zastosowań komercyjnych, zastosowań diagnostycznych in vitro, zastosowań terapeutycznych ex vivo lub in vivo lub jakiegokolwiek rodzaju konsumpcji lub zastosowania u ludzi lub zwierząt.
Ta strona może zawierać tekst przetłumaczony maszynowo.
Nie możesz znaleźć właściwego produktu?
Wypróbuj nasz Narzędzie selektora produktów.
Kod klasy składowania
10 - Combustible liquids
Klasa zagrożenia wodnego (WGK)
WGK 1
Temperatura zapłonu (°F)
Not applicable
Temperatura zapłonu (°C)
Not applicable
Środki ochrony indywidualnej
Eyeshields, Gloves, multi-purpose combination respirator cartridge (US)
Wybierz jedną z najnowszych wersji:
Certyfikaty analizy (CoA)
Lot/Batch Number
Nie widzisz odpowiedniej wersji?
Jeśli potrzebujesz konkretnej wersji, możesz wyszukać konkretny certyfikat według numeru partii lub serii.
Masz już ten produkt?
Dokumenty związane z niedawno zakupionymi produktami zostały zamieszczone w Bibliotece dokumentów.
The Cell Cycle: Principles of Control.
DO Morgan
Cell Division, 2, 27-27 (2007)
Elisa Redl et al.
Life science alliance, 4(2) (2020-12-15)
Malignant transformation depends on genetic and epigenetic events that result in a burst of deregulated gene expression and chromatin changes. To dissect the sequence of events in this process, we used a T-cell-specific lymphoma model based on the human oncogenic
Jin T E Lim et al.
Proceedings of the National Academy of Sciences of the United States of America, 102(14), 5156-5161 (2005-03-26)
Cyclin-dependent kinase 6 (CDK6) binds to and is activated by cyclin D1 and thereby enhances the transition of cells through the G1 phase of the cell cycle. The present study indicates that, in human prostate cancer cells, CDK6 can also
Anne Müller et al.
The Journal of clinical investigation, 130(11), 5765-5781 (2020-07-24)
Psoriasis is a frequent, inflammatory skin disease characterized by keratinocyte hyperproliferation and a disease-related infiltration of immune cells. Here, we identified a novel proinflammatory signaling pathway driven by cyclin-dependent kinase 4 (CDK4) and CDK6 and the methyltransferase EZH2 as a
Wen Pan et al.
Scientific reports, 4, 6812-6812 (2014-10-30)
Cytokines are soluble proteins that exert their functions by binding specific receptors. Many cytokines play essential roles in carcinogenesis and have been developed for the treatment of cancer. In this study, we identified a novel potential cytokine using immunogenomics designated
Nasz zespół naukowców ma doświadczenie we wszystkich obszarach badań, w tym w naukach przyrodniczych, materiałoznawstwie, syntezie chemicznej, chromatografii, analityce i wielu innych dziedzinach.
Skontaktuj się z zespołem ds. pomocy technicznej