Przejdź do zawartości
Merck
Wszystkie zdjęcia(3)

Key Documents

AV46350

Sigma-Aldrich

Anti-CDT1 antibody produced in rabbit

affinity isolated antibody

Synonim(y):

Anti-Chromatin licensing and DNA replication factor 1, Anti-DUP, Anti-RIS2

Zaloguj sięWyświetlanie cen organizacyjnych i kontraktowych
Wszystkie zdjęcia(3)

About This Item

Kod UNSPSC:
12352203
NACRES:
NA.41

pochodzenie biologiczne

rabbit

Poziom jakości

100

białko sprzężone

unconjugated

forma przeciwciała

affinity isolated antibody

rodzaj przeciwciała

primary antibodies

klon

polyclonal

Postać

buffered aqueous solution

masa cząsteczkowa

60 kDa

reaktywność gatunkowa

human, mouse, pig, rat

stężenie

0.5 mg - 1 mg/mL

metody

immunohistochemistry: suitable
western blot: suitable

numer dostępu NCBI

NP_112190

numer dostępu UniProt

Q9H211

Warunki transportu

wet ice

temp. przechowywania

−20°C

docelowa modyfikacja potranslacyjna

unmodified

informacje o genach

human ... CDT1(81620)

Immunogen

Synthetic peptide directed towards the C terminal region of human CDT1

Zastosowanie

Anti-CDT1 antibody produced in rabbit is suitable for western blotting at a concentration of 1μg/ml.

Działania biochem./fizjol.

CDT1 (chromatin licensing and DNA replication factor 1) gene also referred to as DUP or RIS2 encodes for a protein that is a nuclear localizing replication initiation factor and is expressed only during the G1 and S phases of the cell cycle. CDT1 interacts with CDC6 and stimulates the loading of the mini-chromosome maintenance complex onto chromatin. Hence it forms a pre-replication complex necessary to initiate DNA replication. Further, geminin inhibits CDT1 and may facilitate the inhibition of replication at inappropriate origins. Overexpression of Cdt1 mRNA and geminin may play a crucial role in pathogenesis of acute leukemia (AL).

Sekwencja

Synthetic peptide located within the following region: PATPPATPPAASPSALKGVSQDLLERIRAKEAQKQLAQMTRCPEQEQRLQ

Postać fizyczna

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Oświadczenie o zrzeczeniu się odpowiedzialności

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
This page may contain text that has been machine translated.

Nie możesz znaleźć właściwego produktu?  

Wypróbuj nasz Narzędzie selektora produktów.

Kod klasy składowania

10 - Combustible liquids

Klasa zagrożenia wodnego (WGK)

WGK 3

Temperatura zapłonu (°F)

Not applicable

Temperatura zapłonu (°C)

Not applicable

Certyfikaty analizy (CoA)

Poszukaj Certyfikaty analizy (CoA), wpisując numer partii/serii produktów. Numery serii i partii można znaleźć na etykiecie produktu po słowach „seria” lub „partia”.

Masz już ten produkt?

Dokumenty związane z niedawno zakupionymi produktami zostały zamieszczone w Bibliotece dokumentów.

Odwiedź Bibliotekę dokumentów

Ke-Hua Zhang et al.
Zhongguo shi yan xue ye xue za zhi, 19(3), 578-581 (2011-07-07)
The purpose of this study was to detect the expression levels of geminin and cdt1 in peripheral blood and bone marrow from patients with newly diagnosed acute leukemia (AL), and further explore effects of them in the pathogenesis of AL.
J A Wohlschlegel et al.
Science (New York, N.Y.), 290(5500), 2309-2312 (2000-12-23)
In all eukaryotic organisms, inappropriate firing of replication origins during the G2 phase of the cell cycle is suppressed by cyclin-dependent kinases. Multicellular eukaryotes contain a second putative inhibitor of re-replication called geminin. Geminin is believed to block binding of
Jeanette Gowen Cook et al.
The Journal of biological chemistry, 279(10), 9625-9633 (2003-12-16)
Chromosomal DNA replication requires the recruitment of the six-subunit minichromosome maintenance (Mcm) complex to chromatin through the action of Cdc6 and Cdt1. Although considerable work has described the functions of Cdc6 and Cdt1 in yeast and biochemical systems, evidence that
Zannel Blanchard et al.
PloS one, 9(4), e95663-e95663 (2014-05-03)
Breast cancer is the second leading cause of cancer-related deaths in women. Triple negative breast cancer (TNBC) is an aggressive subtype that affects 10-25% mostly African American women. TNBC has the poorest prognosis of all subtypes with rapid progression leading

Nasz zespół naukowców ma doświadczenie we wszystkich obszarach badań, w tym w naukach przyrodniczych, materiałoznawstwie, syntezie chemicznej, chromatografii, analityce i wielu innych dziedzinach.

Skontaktuj się z zespołem ds. pomocy technicznej