Przejdź do zawartości
Merck

AV46129

Sigma-Aldrich

Anti-SHMT2 (AB1) antibody produced in rabbit

affinity isolated antibody

Synonim(y):

Anti-GLYA, Anti-SHMT, Anti-Serine hydroxymethyltransferase 2 (mitochondrial)

Zaloguj sięWyświetlanie cen organizacyjnych i kontraktowych


About This Item

Kod UNSPSC:
12352203
NACRES:
NA.41

pochodzenie biologiczne

rabbit

Poziom jakości

białko sprzężone

unconjugated

forma przeciwciała

affinity isolated antibody

rodzaj przeciwciała

primary antibodies

klon

polyclonal

Postać

buffered aqueous solution

masa cząsteczkowa

56 kDa

reaktywność gatunkowa

horse, dog, rat, guinea pig, mouse, human, rabbit

stężenie

0.5 mg - 1 mg/mL

metody

immunohistochemistry: suitable
western blot: suitable

numer dostępu NCBI

numer dostępu UniProt

Warunki transportu

wet ice

temp. przechowywania

−20°C

docelowa modyfikacja potranslacyjna

unmodified

informacje o genach

human ... SHMT2(6472)

Immunogen

Synthetic peptide directed towards the C terminal region of human SHMT2

Zastosowanie

Anti-SHMT2 (AB1) antibody produced in rabbit is suitable for western blotting at a concentration of 0.5μg/ml and for immunohistochemistry at a concentration of 4-8μg/ml.

Działania biochem./fizjol.

SHMT2 gene encodes an enzyme serine hydroxymethyltransferase 2 (mitochondrial), which is a pyridoxal phosphate-dependent enzyme that regulates the biosynthesis of thymidylate in mammals. It catalyzes the reversible reaction of serine and tetrahydrofolate to glycine and 5,10-methylene tetrahydrofolate. Additionally, it facilitates the interconversion of serine and glycine and is associated with mitochondrial DNA which assists in preventing the uracil accumulation in mtDNA.

Sekwencja

Synthetic peptide located within the following region: ELVSITANKNTCPGDRSAITPGGLRLGAPALTSRQFREDDFRRVVDFIDE

Postać fizyczna

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Oświadczenie o zrzeczeniu się odpowiedzialności

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
This page may contain text that has been machine translated.

Not finding the right product?  

Try our Narzędzie selektora produktów.

Kod klasy składowania

10 - Combustible liquids

Klasa zagrożenia wodnego (WGK)

WGK 3

Temperatura zapłonu (°F)

Not applicable

Temperatura zapłonu (°C)

Not applicable


Certyfikaty analizy (CoA)

Poszukaj Certyfikaty analizy (CoA), wpisując numer partii/serii produktów. Numery serii i partii można znaleźć na etykiecie produktu po słowach „seria” lub „partia”.

Masz już ten produkt?

Dokumenty związane z niedawno zakupionymi produktami zostały zamieszczone w Bibliotece dokumentów.

Odwiedź Bibliotekę dokumentów

Donald D Anderson et al.
PloS one, 4(6), e5839-e5839 (2009-06-11)
The three enzymes that constitute the de novo thymidylate synthesis pathway in mammals, cytoplasmic serine hydroxymethyltransferase (SHMT1), thymidylate synthase (TYMS) and dihydrofolate reductase (DHFR) undergo sumoylation and nuclear import during S-phase. In this study, we demonstrate that purified intact mouse
Donald D Anderson et al.
Proceedings of the National Academy of Sciences of the United States of America, 108(37), 15163-15168 (2011-08-31)
The de novo and salvage dTTP pathways are essential for maintaining cellular dTTP pools to ensure the faithful replication of both mitochondrial and nuclear DNA. Disregulation of dTTP pools results in mitochondrial dysfunction and nuclear genome instability due to an

Nasz zespół naukowców ma doświadczenie we wszystkich obszarach badań, w tym w naukach przyrodniczych, materiałoznawstwie, syntezie chemicznej, chromatografii, analityce i wielu innych dziedzinach.

Skontaktuj się z zespołem ds. pomocy technicznej