Przejdź do zawartości
Merck
Wszystkie zdjęcia(1)

Key Documents

AV46013

Sigma-Aldrich

Anti-PRIM1 antibody produced in rabbit

IgG fraction of antiserum

Synonim(y):

Anti-MGC12308, Anti-Primase, polypeptide 1, 49 kDa, Anti-p49

Zaloguj sięWyświetlanie cen organizacyjnych i kontraktowych


About This Item

Kod UNSPSC:
12352203
NACRES:
NA.41

pochodzenie biologiczne

rabbit

Poziom jakości

białko sprzężone

unconjugated

forma przeciwciała

IgG fraction of antiserum

rodzaj przeciwciała

primary antibodies

klon

polyclonal

Postać

buffered aqueous solution

masa cząsteczkowa

50 kDa

reaktywność gatunkowa

rabbit, rat, guinea pig, bovine, human, horse, mouse

stężenie

0.5 mg - 1 mg/mL

metody

western blot: suitable

numer dostępu NCBI

numer dostępu UniProt

Warunki transportu

wet ice

temp. przechowywania

−20°C

docelowa modyfikacja potranslacyjna

unmodified

informacje o genach

human ... PRIM1(5557)

Immunogen

Synthetic peptide directed towards the N terminal region of human PRIM1

Zastosowanie

Anti-PRIM1 antibody produced in rabbit is suitable for western blotting at a concentration of 1.25μg/ml.

Działania biochem./fizjol.

Human DNA primase 1 (PRIM1) is a pivotal enzyme component of complex chromosomal replication apparatus. It functions in synchronization with DNA polymerase alpha during replication in eukaryotic cells. DNA primase facilitates the synthesis of small RNA primers that initiate synthesis of the lagging DNA strand.

Sekwencja

Synthetic peptide located within the following region: SQYYRWLNYGGVIKNYFQHREFSFTLKDDIYIRYQSFNNQSDLEKEMQKM

Postać fizyczna

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Oświadczenie o zrzeczeniu się odpowiedzialności

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
This page may contain text that has been machine translated.

Nie możesz znaleźć właściwego produktu?  

Wypróbuj nasz Narzędzie selektora produktów.

Kod klasy składowania

10 - Combustible liquids

Klasa zagrożenia wodnego (WGK)

WGK 3

Temperatura zapłonu (°F)

Not applicable

Temperatura zapłonu (°C)

Not applicable


Certyfikaty analizy (CoA)

Poszukaj Certyfikaty analizy (CoA), wpisując numer partii/serii produktów. Numery serii i partii można znaleźć na etykiecie produktu po słowach „seria” lub „partia”.

Masz już ten produkt?

Dokumenty związane z niedawno zakupionymi produktami zostały zamieszczone w Bibliotece dokumentów.

Odwiedź Bibliotekę dokumentów

Mairi L Kilkenny et al.
The Journal of biological chemistry, 287(28), 23740-23747 (2012-05-18)
The DNA polymerase α-primase complex forms an essential part of the eukaryotic replisome. The catalytic subunits of primase and pol α synthesize composite RNA-DNA primers that initiate the leading and lagging DNA strands at replication forks. The physical basis and
F Stadlbauer et al.
European journal of biochemistry, 222(3), 781-793 (1994-06-15)
DNA-polymerase-alpha--primase complex contains four subunits, p180, p68, p58, and p48, and comprises a minimum of two enzymic functions. We have cloned cDNAs encoding subunits of DNA-polymerase-alpha--primase from human and mouse. Sequence comparisons showed high amino acid conservation among the mammalian

Nasz zespół naukowców ma doświadczenie we wszystkich obszarach badań, w tym w naukach przyrodniczych, materiałoznawstwie, syntezie chemicznej, chromatografii, analityce i wielu innych dziedzinach.

Skontaktuj się z zespołem ds. pomocy technicznej