Przejdź do zawartości
Merck
Wszystkie zdjęcia(2)

Key Documents

AV44694

Sigma-Aldrich

Anti-MPG antibody produced in rabbit

affinity isolated antibody

Synonim(y):

Anti-AAG, Anti-APNG, Anti-CRA36.1, Anti-MDG, Anti-Mid1, Anti-N-Methylpurine-DNA glycosylase, Anti-PIG11, Anti-PIG16

Zaloguj sięWyświetlanie cen organizacyjnych i kontraktowych
Wszystkie zdjęcia(2)

About This Item

Kod UNSPSC:
12352203
NACRES:
NA.41

pochodzenie biologiczne

rabbit

Poziom jakości

100

białko sprzężone

unconjugated

forma przeciwciała

affinity isolated antibody

rodzaj przeciwciała

primary antibodies

klon

polyclonal

Postać

buffered aqueous solution

masa cząsteczkowa

32 kDa

reaktywność gatunkowa

rat, mouse, human

stężenie

0.5 mg - 1 mg/mL

metody

western blot: suitable

numer dostępu NCBI

NP_001015052

numer dostępu UniProt

Q5J9I4

Warunki transportu

wet ice

temp. przechowywania

−20°C

docelowa modyfikacja potranslacyjna

unmodified

informacje o genach

human ... MPG(4350)

Immunogen

Synthetic peptide directed towards the C terminal region of human MPG

Zastosowanie

Anti-MPG antibody produced in rabbit is suitable for western blotting at a concentration of 0.5μg/ml.

Działania biochem./fizjol.

N-methylpurine-DNA glycosylase (MPG) is an enzyme that repairs the genome-wide damage caused by alkylating agents. MPG repairs the hypoxanthine that is formed by the deamination of adenine and 1,N6-ethenoadenine formed as a result of interaction of lipid peroxidation-derived aldehydes and hydroxyalkenals with DNA. A functional linkage between MPG and p53; MPG acting as the selective regulator of p53-mediated cell cycle arrest.

Sekwencja

Synthetic peptide located within the following region: LEPSEPAVVAAARVGVGHAGEWARKPLRFYVRGSPWVSVVDRVAEQDTQA

Postać fizyczna

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Oświadczenie o zrzeczeniu się odpowiedzialności

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
This page may contain text that has been machine translated.

Nie możesz znaleźć właściwego produktu?  

Wypróbuj nasz Narzędzie selektora produktów.

Kod klasy składowania

10 - Combustible liquids

Klasa zagrożenia wodnego (WGK)

WGK 3

Temperatura zapłonu (°F)

Not applicable

Temperatura zapłonu (°C)

Not applicable

Certyfikaty analizy (CoA)

Poszukaj Certyfikaty analizy (CoA), wpisując numer partii/serii produktów. Numery serii i partii można znaleźć na etykiecie produktu po słowach „seria” lub „partia”.

Masz już ten produkt?

Dokumenty związane z niedawno zakupionymi produktami zostały zamieszczone w Bibliotece dokumentów.

Odwiedź Bibliotekę dokumentów

Robyn L Maher et al.
DNA repair, 6(1), 71-81 (2006-10-05)
The base excision repair pathway removes damaged DNA bases and resynthesizes DNA to replace the damage. Human alkyladenine DNA glycosylase (AAG) is one of several damage-specific DNA glycosylases that recognizes and excises damaged DNA bases. AAG removes primarily damaged adenine
Yael Leitner-Dagan et al.
Journal of the National Cancer Institute, 104(22), 1765-1769 (2012-10-30)
Only a minority of smokers develop lung cancer, possibly due to genetic predisposition, including DNA repair deficiencies. To examine whether inter-individual variations in DNA repair activity of N-methylpurine DNA glycosylase (MPG) are associated with lung cancer, we conducted a blinded
Shanshan Song et al.
Cell research, 22(8), 1285-1303 (2012-07-18)
Alkylating agents induce genome-wide base damage, which is repaired mainly by N-methylpurine DNA glycosylase (MPG). An elevated expression of MPG in certain types of tumor cells confers higher sensitivity to alkylation agents because MPG-induced apurinic/apyrimidic (AP) sites trigger more strand
Chun-Yue I Lee et al.
Biochemistry, 48(9), 1850-1861 (2009-02-18)
The human 3-methyladenine DNA glycosylase (AAG) recognizes and excises a broad range of purines damaged by alkylation and oxidative damage, including 3-methyladenine, 7-methylguanine, hypoxanthine (Hx), and 1,N(6)-ethenoadenine (epsilonA). The crystal structures of AAG bound to epsilonA have provided insights into

Nasz zespół naukowców ma doświadczenie we wszystkich obszarach badań, w tym w naukach przyrodniczych, materiałoznawstwie, syntezie chemicznej, chromatografii, analityce i wielu innych dziedzinach.

Skontaktuj się z zespołem ds. pomocy technicznej