Przejdź do zawartości
Merck
Wszystkie zdjęcia(2)

Kluczowe dokumenty

AV43519

Sigma-Aldrich

Anti-M6PR antibody produced in rabbit

IgG fraction of antiserum

Synonim(y):

Anti-CD-MPR, Anti-FLJ32994, Anti-MPR46, Anti-Mannose-6-phosphate receptor (cation dependent), Anti-SMPR

Zaloguj sięWyświetlanie cen organizacyjnych i kontraktowych


About This Item

Kod UNSPSC:
12352203
NACRES:
NA.41

pochodzenie biologiczne

rabbit

Poziom jakości

białko sprzężone

unconjugated

forma przeciwciała

IgG fraction of antiserum

rodzaj przeciwciała

primary antibodies

klon

polyclonal

Postać

buffered aqueous solution

masa cząsteczkowa

28 kDa

reaktywność gatunkowa

mouse, human, rabbit, guinea pig, rat

stężenie

0.5 mg - 1 mg/mL

metody

western blot: suitable

numer dostępu NCBI

numer dostępu UniProt

Warunki transportu

wet ice

temp. przechowywania

−20°C

docelowa modyfikacja potranslacyjna

unmodified

informacje o genach

human ... M6PR(4074)

Opis ogólny

Mannose-6-phosphate receptor (cation dependent) (M6PR) is a receptor for mannose-6-phosphate groups on lysosomal enzymes. It is an integral membrane protein that belongs to type I membrane-spanning glycoproteins. M6PR protein exists as a homodimer and localizes in the trans-Golgi reticulum, endosomes, and the plasma membrane. M6PR gene is mapped to human chromosome 12p13.31.

Immunogen

Synthetic peptide directed towards the N terminal region of human M6PR

Działania biochem./fizjol.

Mannose-6-phosphate receptor (cation dependent) (M6PR) aids in intracellular targeting of lysosomal enzymes. It mediates the export of newly synthesized acid hydrolases from the trans-Golgi network (TGN) to endosomes for their subsequent transfer to lysosomes. The presence of a cytoplasmic tail in M6PR protects it from lysosomal degradation. in vitro studies suggest that M6PR favors the secretion of pro-cathepsin D in breast cancer cells.

Sekwencja

Synthetic peptide located within the following region: RLKPLFNKSFESTVGQGSDTYIYIFRVCREAGNHTSGAGLVQINKSNGKE

Postać fizyczna

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Oświadczenie o zrzeczeniu się odpowiedzialności

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
Ta strona może zawierać tekst przetłumaczony maszynowo.

Nie możesz znaleźć właściwego produktu?  

Wypróbuj nasz Narzędzie selektora produktów.

Kod klasy składowania

10 - Combustible liquids

Klasa zagrożenia wodnego (WGK)

WGK 3

Temperatura zapłonu (°F)

Not applicable

Temperatura zapłonu (°C)

Not applicable


Certyfikaty analizy (CoA)

Poszukaj Certyfikaty analizy (CoA), wpisując numer partii/serii produktów. Numery serii i partii można znaleźć na etykiecie produktu po słowach „seria” lub „partia”.

Masz już ten produkt?

Dokumenty związane z niedawno zakupionymi produktami zostały zamieszczone w Bibliotece dokumentów.

Odwiedź Bibliotekę dokumentów

Balraj Doray et al.
The Journal of biological chemistry, 277(21), 18477-18482 (2002-03-12)
The GGAs (Golgi-localizing, gamma-adaptin ear homology domain, ARF-binding) are a multidomain family of proteins implicated in protein trafficking between the Golgi and endosomes. Recent evidence has established that the cation-independent (CI) and cation-dependent (CD) mannose 6-phosphate receptors (MPRs) bind specifically
Pradipta Ghosh et al.
Nature reviews. Molecular cell biology, 4(3), 202-212 (2003-03-04)
The two mannose 6-phosphate (M6P) receptors were identified because of their ability to bind M6P-containing soluble acid hydrolases in the Golgi and transport them to the endosomal-lysosomal system. During the past decade, we have started to understand the structural features

Nasz zespół naukowców ma doświadczenie we wszystkich obszarach badań, w tym w naukach przyrodniczych, materiałoznawstwie, syntezie chemicznej, chromatografii, analityce i wielu innych dziedzinach.

Skontaktuj się z zespołem ds. pomocy technicznej