AV42559

Anti-ANKRD2 antibody produced in rabbit

affinity isolated antibody

• Synonim(y): Anti-ARPP, Anti-Ankyrin repeat domain 2 (stretch responsive muscle), Anti-MGC104314
• Kod UNSPSC: 12352203
• NACRES: NA.41

Właściwości

• pochodzenie biologiczne: rabbit
• Poziom jakości: 100
• białko sprzężone: unconjugated
• forma przeciwciała: affinity isolated antibody
• rodzaj przeciwciała: primary antibodies
• klon: polyclonal
• Formularz: buffered aqueous solution
• masa cząsteczkowa: 49 kDa
• reaktywność gatunkowa: guinea pig, horse, mouse, rabbit, human, dog, bovine, rat
• stężenie: 0.5 mg - 1 mg/mL
• metody: western blot: suitable
• numer dostępu NCBI: NP_001123453
• numer dostępu UniProt: Q3B778
• Warunki transportu: wet ice
• temp. przechowywania: −20°C
• docelowa modyfikacja potranslacyjna: unmodified
• informacje o genach: human ... ANKRD2(26287)

Opis

Opis ogólny

Ankyrin repeat domain 2 (stretch responsive muscle) (Ankrd2), a MARP mechanosensing protein, is believed to be involved in skeletal muscle hypertrophy through the regulation of cell signaling and gene expression within muscle cells.

Specyficzność

Anti-ANKRD2 antibody reacts with canine, human, mouse, and rat ankyrin repeat domain 2 (stretch responsive muscle) proteins.

Immunogen

Synthetic peptide directed towards the N terminal region of human ANKRD2

Zastosowanie

Anti-ANKRD2 polyclonal antibody is used to tag Ankyrin repeat domain 2 proteins for detection and quantitation by Western blotting and in cells and tissues by immunohistochemical (IHC) techniques. It is used as a probe to study the role Ankrd2 in muscle cell development.

Działania biochem./fizjol.

ANKRD2 may play an important role in skeletal muscle hypertrophy.

Sekwencja

Synthetic peptide located within the following region: QEEENEKLRGDARQKLPMDLLVLEDEKHHGAQSAALQKVKGQERVRKTSL

Postać fizyczna

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Oświadczenie o zrzeczeniu się odpowiedzialności

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Ta strona może zawierać tekst przetłumaczony maszynowo.

Informacja o środkach bezpieczeństwa

• Kod klasy składowania: 10 - Combustible liquids
• Klasa zagrożenia wodnego (WGK): WGK 3
• Temperatura zapłonu (°F): Not applicable
• Temperatura zapłonu (°C): Not applicable