AV42318

Anti-SLC20A2 antibody produced in rabbit

affinity isolated antibody

• Synonim(y): Anti-GLVR2, Anti-Glvr-2, Anti-MLVAR, Anti-PIT-2, Anti-Solute carrier family 20 (phosphate transporter), member 2
• Kod UNSPSC: 12352203
• NACRES: NA.41

Właściwości

• pochodzenie biologiczne: rabbit
• Poziom jakości: 100
• białko sprzężone: unconjugated
• forma przeciwciała: affinity isolated antibody
• rodzaj przeciwciała: primary antibodies
• klon: polyclonal
• Postać: buffered aqueous solution
• masa cząsteczkowa: 70 kDa
• reaktywność gatunkowa: guinea pig, bovine, rat, human, dog, mouse, horse, rabbit
• stężenie: 0.5 mg - 1 mg/mL
• metody: western blot: suitable
• numer dostępu NCBI: NP_006740
• numer dostępu UniProt: Q08357
• Warunki transportu: wet ice
• temp. przechowywania: −20°C
• docelowa modyfikacja potranslacyjna: unmodified
• informacje o genach: human ... SLC20A2(6575)

Opis

Opis ogólny

Solute carrier family 20 (phosphate transporter), member 2 (SLC20A2, GLVR2, MLVAR, PIT-2) is a type III Na+-dependent Pi transporter responsible for the transport of inorganic phosphate (Pi) and maintenance of Pi homeostasis that supports biological processes such as nucleic acid synthesis, tooth mineralization, skeletal development and various signaling cascades. Defective SLC20a2 is associated with idiopathic basal ganglia calcification (Fahr′s syndrome).

Specyficzność

Anti-SLC20A2 polyclonal antibody reacts with bovine, chicken, human, mouse, rat, canine, and zebrafish solute carrier family 20 (phosphate transporter) member 2 proteins.

Immunogen

Synthetic peptide directed towards the N terminal region of human SLC20A2

Zastosowanie

Anti-SLC20A2 polyclonal antibody is used to tag solute carrier family 20 (phosphate transporter) member 2/ gibbon ape leukemia virus 2 protein for detection and quantitation by Western blotting and in plasma by immunohistochemical (IHC) techniques. It is used as a probe to determine the roles of solute carrier family 20 (phosphate transporter) member 2/gibbon ape leukemia virus 2 protein in Pi homeostasis.

Sekwencja

Synthetic peptide located within the following region: DVNLYNETVETLMAGEVSAMVGSAVWQLIASFLRLPISGTHCIVGSTIGF

Postać fizyczna

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Oświadczenie o zrzeczeniu się odpowiedzialności

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

This page may contain text that has been machine translated.

Informacja o środkach bezpieczeństwa

• Kod klasy składowania: 10 - Combustible liquids
• Klasa zagrożenia wodnego (WGK): WGK 3
• Temperatura zapłonu (°F): Not applicable
• Temperatura zapłonu (°C): Not applicable