AV39172

Anti-POGZ antibody produced in rabbit

IgG fraction of antiserum

• Synonim(y): Anti-Pogo transposable element with ZNF domain
• Kod UNSPSC: 12352203
• NACRES: NA.41

Właściwości

• pochodzenie biologiczne: rabbit
• Poziom jakości: 100
• białko sprzężone: unconjugated
• forma przeciwciała: IgG fraction of antiserum
• rodzaj przeciwciała: primary antibodies
• klon: polyclonal
• Postać: buffered aqueous solution
• masa cząsteczkowa: 155 kDa
• reaktywność gatunkowa: rat, mouse, dog, bovine, rabbit, guinea pig, horse, human
• stężenie: 0.5 mg - 1 mg/mL
• metody: immunohistochemistry: suitable; western blot: suitable
• numer dostępu NCBI: NP_055915
• numer dostępu UniProt: Q7Z3K3
• Warunki transportu: wet ice
• temp. przechowywania: −20°C
• docelowa modyfikacja potranslacyjna: unmodified
• informacje o genach: human ... POGZ(23126)

Opis

Opis ogólny

POGZ is a zinc-finger protein known to interact with HP1α. Studies have reported that POGZ regulates the dissociation of Aurora B kinase from chromosomal arms during the M phase of the cell cycle.
Rabbit Anti-POGZ antibody recognizes human, mouse, rat, canine, rabbit, and bovine POGZ.

Immunogen

Synthetic peptide directed towards the N terminal region of human POGZ

Zastosowanie

Rabbit Anti-POGZ antibody is suitable for western blot (5.0 μg/ml) and IHC (4-8 μg/ml) applications.

Działania biochem./fizjol.

POGZ appears to be a zinc finger protein containing a transposase domain at the C-terminus. This protein was found to interact with the transcription factor SP1 in a yeast two-hybrid systemThe protein encoded by this gene appears to be a zinc finger protein containing a transposase domain at the C-terminus. This protein was found to interact with the transcription factor SP1 in a yeast two-hybrid system. At least three alternatively spliced transcript variants encoding distinct isoforms have been observed.

Sekwencja

Synthetic peptide located within the following region: EELEPWQKISDVIEDSVVEDYNSVDKTTTVSVSQQPVSAPVPIAAHASVA

Postać fizyczna

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Oświadczenie o zrzeczeniu się odpowiedzialności

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

This page may contain text that has been machine translated.

Informacja o środkach bezpieczeństwa

• Kod klasy składowania: 10 - Combustible liquids
• Klasa zagrożenia wodnego (WGK): WGK 1
• Temperatura zapłonu (°F): Not applicable
• Temperatura zapłonu (°C): Not applicable