Przejdź do zawartości
Merck
Wszystkie zdjęcia(3)

Key Documents

AV38780

Sigma-Aldrich

Anti-SMC1A antibody produced in rabbit

affinity isolated antibody

Synonim(y):

Anti-CDLS2, Anti-DKFZp686L19178, Anti-DXS423E, Anti-KIAA0178, Anti-MGC138332, Anti-SB1.8, Anti-SMC1, Anti-Structural maintenance of chromosomes 1A

Zaloguj sięWyświetlanie cen organizacyjnych i kontraktowych
Wszystkie zdjęcia(3)

About This Item

Kod UNSPSC:
12352203
NACRES:
NA.41

pochodzenie biologiczne

rabbit

Poziom jakości

100

białko sprzężone

unconjugated

forma przeciwciała

affinity isolated antibody

rodzaj przeciwciała

primary antibodies

klon

polyclonal

Postać

buffered aqueous solution

masa cząsteczkowa

143 kDa

reaktywność gatunkowa

human, rabbit, guinea pig, mouse, dog, rat, bovine, horse

stężenie

0.5 mg - 1 mg/mL

metody

immunohistochemistry: suitable
western blot: suitable

numer dostępu NCBI

NP_006297

numer dostępu UniProt

Q14683

Warunki transportu

wet ice

temp. przechowywania

−20°C

docelowa modyfikacja potranslacyjna

unmodified

informacje o genach

human ... SMC1A(8243)

Immunogen

Synthetic peptide directed towards the C terminal region of human SMC1A

Działania biochem./fizjol.

Structural maintenance of chromosomes (SMC) proteins maintain the sister chromatid cohesion during the process of cell division. SMC1A is present in the kinetochore, interacts with BRCA1 and ATM proteins indicating a role in DNA repair. It is reportedly involved in the G2/M transition of human glioma cells and G1/S transition of human lung adenocarcinoma cells.

Sekwencja

Synthetic peptide located within the following region: VISLKEEFYTKAESLIGVYPEQGDCVISKVLTFDLTKYPDANPNPNEQ

Postać fizyczna

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Oświadczenie o zrzeczeniu się odpowiedzialności

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
This page may contain text that has been machine translated.

Nie możesz znaleźć właściwego produktu?  

Wypróbuj nasz Narzędzie selektora produktów.

Kod klasy składowania

10 - Combustible liquids

Klasa zagrożenia wodnego (WGK)

WGK 2

Temperatura zapłonu (°F)

Not applicable

Temperatura zapłonu (°C)

Not applicable

Certyfikaty analizy (CoA)

Poszukaj Certyfikaty analizy (CoA), wpisując numer partii/serii produktów. Numery serii i partii można znaleźć na etykiecie produktu po słowach „seria” lub „partia”.

Masz już ten produkt?

Dokumenty związane z niedawno zakupionymi produktami zostały zamieszczone w Bibliotece dokumentów.

Odwiedź Bibliotekę dokumentów

Zengyi Ma et al.
International journal of clinical and experimental pathology, 6(5), 862-869 (2013-05-03)
Cohesin, a multiunit complex of SMC1A, SMC3 and Rad21, associates with chromatin after mitosis and holds sister chromatids together following DNA replication. It has been reported that SMC1A is mutated in some cancer types, leading to genomic instability and abnormal
Magtouf Gatei et al.
The Journal of biological chemistry, 286(36), 31542-31556 (2011-07-16)
The Mre11/Rad50/NBN complex plays a central role in coordinating the cellular response to DNA double-strand breaks. The importance of Rad50 in that response is evident from the recent description of a patient with Rad50 deficiency characterized by chromosomal instability and
Eui Young So et al.
Cancer biology & therapy, 15(7), 906-910 (2014-04-24)
The bone marrow (BM) is one of the organs that is sensitive to acute exposure of ionizing radiation (IR); however, the mechanism of its high sensitivity to IR remains to be elucidated. BM is differentiated into dendritic cells (DC) with

Nasz zespół naukowców ma doświadczenie we wszystkich obszarach badań, w tym w naukach przyrodniczych, materiałoznawstwie, syntezie chemicznej, chromatografii, analityce i wielu innych dziedzinach.

Skontaktuj się z zespołem ds. pomocy technicznej