AV33727

Anti-NFE2L3 antibody produced in rabbit

affinity isolated antibody

• Synonim(y): Anti-NRF3, Anti-Nuclear factor (erythroid-derived 2)-like 3
• Kod UNSPSC: 12352203
• NACRES: NA.41
• białko sprzężone: unconjugated
• application: WB
• klon: polyclonal
• reaktywność gatunkowa: human
• citations: 1
• metody: western blot: suitable

Właściwości

• pochodzenie biologiczne: rabbit
• Poziom jakości: 100
• białko sprzężone: unconjugated
• forma przeciwciała: affinity isolated antibody
• rodzaj przeciwciała: primary antibodies
• klon: polyclonal
• Formularz: buffered aqueous solution
• masa cząsteczkowa: 76 kDa
• reaktywność gatunkowa: human
• stężenie: 0.5 mg - 1 mg/mL
• metody: western blot: suitable
• numer dostępu NCBI: NP_004280
• numer dostępu UniProt: Q9Y4A8
• Warunki transportu: wet ice
• temp. przechowywania: −20°C
• docelowa modyfikacja potranslacyjna: unmodified
• informacje o genach: human ... NFE2L3(9603)

Opis

Opis ogólny

Nuclear factor erythroid 2-related factor 3, NFE2L3, is a basic-region leucine zipper (bZIP) transcription factor. It is a glycoprotein expressed in the endoplasmic reticulum and the nuclear membrane.

Immunogen

Synthetic peptide directed towards the middle region of human NFE2L3

Działania biochem./fizjol.

NFE2L3 activates erythroid-specific, globin gene expression.

Sekwencja

Synthetic peptide located within the following region: NPEQTLPGTNLTGFLSPVDNHMRNLTSQDLLYDLDINIFDEINLMSLATE

Postać fizyczna

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Oświadczenie o zrzeczeniu się odpowiedzialności

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Ta strona może zawierać tekst przetłumaczony maszynowo.

Informacja o środkach bezpieczeństwa

• Kod klasy składowania: 10 - Combustible liquids
• Klasa zagrożenia wodnego (WGK): WGK 3
• Temperatura zapłonu (°F): Not applicable
• Temperatura zapłonu (°C): Not applicable