AV32880

Anti-PPARG (AB1) antibody produced in rabbit

IgG fraction of antiserum

• Synonim(y): Anti-Peroxisome proliferator-activated receptor γ
• Kod UNSPSC: 12352203
• NACRES: NA.41

Właściwości

• pochodzenie biologiczne: rabbit
• Poziom jakości: 100
• białko sprzężone: unconjugated
• forma przeciwciała: IgG fraction of antiserum
• rodzaj przeciwciała: primary antibodies
• klon: polyclonal
• Postać: buffered aqueous solution
• masa cząsteczkowa: 56 kDa
• reaktywność gatunkowa: rabbit, rat, mouse, horse, guinea pig, human, dog
• stężenie: 0.5 mg - 1 mg/mL
• metody: immunohistochemistry: suitable; western blot: suitable
• numer dostępu NCBI: NP_005028
• numer dostępu UniProt: P37231
• Warunki transportu: wet ice
• temp. przechowywania: −20°C
• docelowa modyfikacja potranslacyjna: unmodified
• informacje o genach: human ... PPARG(5468)

Opis

Opis ogólny

Peroxisome proliferator-activated receptor gamma/glitazone receptor (PPARG, NR1C3) is a type II nuclear receptor involved in the regulation of fatty acid storage and glucose metabolism. PPARG activation stimulates lipid uptake and adipocyte differention/adipogenesis. PPARG is a component of pathologies such as diabetes, atherosclerosis, and cancer. PPARG helps regulate the inflammatory response of endothelial cells.

Rabbit polyclonal anti-PPARG (AB1) antibody reacts with bovine, canine, human, mouse, rat, chicken, rabbit, and pig peroxisome proliferator-activated receptor gamma/glitazone receptors.

Immunogen

Synthetic peptide directed towards the N terminal region of human PPARG

Zastosowanie

Rabbit Anti-PPARG has been used at a dilution of 1:50 for IHC applications. It can also be used for western blot at 1.25 μg/ml.

Rabbit polyclonal anti-PPARG (AB1) antibody is used to tag peroxisome proliferator-activated receptor gamma/glitazone for detection and quantitation by immunocytochemical and immunohistochemical (IHC) techniques. It is used as a probe to determine the presence and roles of peroxisome proliferator-activated receptor gamma/glitazone receptor in lipid and glucose metabolism, adipocyte differentiation and potential associated diseases such as diabetes, atherosclerosis, and cancer.

Działania biochem./fizjol.

PPARG is a regulator of adipocyte differentiation. Additionally, PPAR-gamma has been implicated in the pathology of numerous diseases including obesity, diabetes, atherosclerosis and cancer.

Sekwencja

Synthetic peptide located within the following region: SHSFDIKPFTTVDFSSISTPHYEDIPFTRTDPVVADYKYDLKLQEYQSAI

Postać fizyczna

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Oświadczenie o zrzeczeniu się odpowiedzialności

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

This page may contain text that has been machine translated.

Informacja o środkach bezpieczeństwa

• Kod klasy składowania: 10 - Combustible liquids
• Klasa zagrożenia wodnego (WGK): WGK 3
• Temperatura zapłonu (°F): Not applicable
• Temperatura zapłonu (°C): Not applicable