AV31839

Anti-PTF1A antibody produced in rabbit

IgG fraction of antiserum

• Synonim(y): Anti-Pancreas specific transcription factor, 1a
• Kod UNSPSC: 12352203
• NACRES: NA.41

Właściwości

• pochodzenie biologiczne: rabbit
• Poziom jakości: 100
• białko sprzężone: unconjugated
• forma przeciwciała: IgG fraction of antiserum
• rodzaj przeciwciała: primary antibodies
• klon: polyclonal
• Postać: buffered aqueous solution
• masa cząsteczkowa: 35 kDa
• reaktywność gatunkowa: human
• stężenie: 0.5 mg - 1 mg/mL
• metody: western blot: suitable
• numer dostępu NCBI: NP_835455
• numer dostępu UniProt: Q7RTS3
• Warunki transportu: wet ice
• temp. przechowywania: −20°C
• docelowa modyfikacja potranslacyjna: unmodified
• informacje o genach: human ... PTF1A(256297)

Opis

Opis ogólny

PTF1A is a part of the pancreas transcription factor 1 complex that regulates the expression of exocrine pancreas-specific genes. Ptf1a is required for GABAergic neuronal cell fates during spinal cord development. Furthermore, Ptf1a provides a link between the development of inhibitory and excitatory interneurons. Mutations in PTF1A have been associated with diabetes mellitus and cerebellar agenesis.
Rabbit Anti-PTF1A antibody recognizes canine, human, mouse, rat, and zebrafish PTF1A.

Immunogen

Synthetic peptide directed towards the N terminal region of human PTF1A

Zastosowanie

Rabbit Anti-PTF1A antibody can be used for western blot application at a concentration of 2.5μg/ml.

Działania biochem./fizjol.

PTF1A is a pancreas specific transcription factor. Mammalian studies have implicated important roles for the basic helix-loop-helix transcription factor PTF1A-p48 in the development of both exocrine and endocrine pancreas.

Sekwencja

Synthetic peptide located within the following region: MDAVLLEHFPGGLDAFPSSYFDEDDFFTDQSSRDPLEDGDELLADEQAEV

Postać fizyczna

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Oświadczenie o zrzeczeniu się odpowiedzialności

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

This page may contain text that has been machine translated.

Informacja o środkach bezpieczeństwa

• Kod klasy składowania: 10 - Combustible liquids
• Klasa zagrożenia wodnego (WGK): WGK 3
• Temperatura zapłonu (°F): Not applicable
• Temperatura zapłonu (°C): Not applicable