Przejdź do zawartości
Merck
Wszystkie zdjęcia(1)

Kluczowe dokumenty

5126

Sigma-Aldrich

CD274 human

recombinant, expressed in E. coli, 0.5 mg protein/mL

Zaloguj sięWyświetlanie cen organizacyjnych i kontraktowych


About This Item

Kod UNSPSC:
12352202
NACRES:
NA.75

pochodzenie biologiczne

human

Poziom jakości

rekombinowane

expressed in E. coli

opis

0.1 mg recombinant human CD274 in 20 mM Tris-HCl buffer, containing NaCl, KCl, EDTA, L-arginine, DTT and glycerol.

sterylność

Filtered sterilized solution

Próba

≥90% (SDS-PAGE)

Formularz

liquid

opakowanie

pkg of 100 μg

stężenie

0.5 mg protein/mL

metody

cell culture | mammalian: suitable

nr dostępu

NP_054862.1

Warunki transportu

dry ice

temp. przechowywania

−20°C

informacje o genach

human ... CD274(29126)

Zastosowanie

Coating a plate well (6 well plate) with this recombinant CD274 protein in a specific culture medium at 5-10 μg/well allows for use 1) as human T and B cells activation/differentiation studies or 2) as a potential biomarker protein for infectious diseases in vitro or 3) for auto-immuno disease diagnostic development.

Use this procedure as a guideline to determine optimal coating conditions for the culture system of choice.
1.Thaw CD274 and dilute to desired concentration using serum-free medium or PBS. The final solution should be sufficiently dilute so the volume added covers the surface evenly (5-10 μg/well, 6 well plate).
2.Add appropriate amount of diluted material to culture surface.
3.Incubate at room temperature for approximately 1.5 hours.
4.Aspirate remaining material.
5.Rinse plates carefully with water and avoid scratching bottom surface of plates.
6.Plates are ready for use. They may also be stored at 2-8 °C damp or air dried if sterility is maintained.

Sekwencja

MASMTGGQQMGRGHHHHHHGNLYFQG^GEFFTVTVPKDLYVVEYGSNMTIECKFPVEKQLDLAALIVYWEMEDKNIIQFVHGEEDLKVQHSSYRQRARLLKDQLSLGNAALQITDVKLQDAGVYRCMISYGGADYKRITVKVNAPYNKINQRILVVDPVTSEHELTCQAEGYPKAEVIWTSSDHQVLSGKTTTTNSKREEKLFNVTSTLRINTTTNEIFYCTFRRLDPEENHTAELVIPELPLAHPPNER

Uwaga dotycząca przygotowania

The extracellular domain of recombinant human CD274 (19-238 aa, derived from BC074984) was constructed with codon optimization and expressed with a small T7-His-TEV cleavage site Tag (29aa) fusion at its N-terminal and expressed in E. coli as inclusion bodies. The final product was refolded using our unique “temperature shift inclusion body refolding” technology and chromatographically purified.
Ta strona może zawierać tekst przetłumaczony maszynowo.

Kod klasy składowania

10 - Combustible liquids

Klasa zagrożenia wodnego (WGK)

WGK 2

Temperatura zapłonu (°F)

Not applicable

Temperatura zapłonu (°C)

Not applicable


Wybierz jedną z najnowszych wersji:

Certyfikaty analizy (CoA)

Lot/Batch Number

Nie widzisz odpowiedniej wersji?

Jeśli potrzebujesz konkretnej wersji, możesz wyszukać konkretny certyfikat według numeru partii lub serii.

Masz już ten produkt?

Dokumenty związane z niedawno zakupionymi produktami zostały zamieszczone w Bibliotece dokumentów.

Odwiedź Bibliotekę dokumentów

Yujia Cao et al.
Cancer research, 71(14), 4737-4741 (2011-07-07)
B7-H1 (CD274), a member of the B7 family of coinhibitory molecules, is often induced in human tumors and its expression is closely correlated with a poor prognosis or higher malignancy grade. Tumor-associated B7-H1 is implicated in mechanisms of immune escape.
Daria Trabattoni et al.
Blood, 101(7), 2514-2520 (2002-12-07)
The ligation of programmed death-ligand 1 (B7-H1) to T cells results in the preferential production of interleukin 10 (IL-10). We investigated if B7-H1 would be up-regulated in HIV infection, a disease characterized by increased IL-10 production, by measuring B7-H1, B7-1
Shoba Amarnath et al.
Science translational medicine, 3(111), 111ra120-111ra120 (2011-12-03)
Immune surveillance by T helper type 1 (T(H)1) cells is not only critical for the host response to tumors and infection, but also contributes to autoimmunity and graft-versus-host disease (GVHD) after transplantation. The inhibitory molecule programmed death ligand 1 (PDL1)
Jun Yang et al.
Journal of immunology (Baltimore, Md. : 1950), 187(3), 1113-1119 (2011-06-24)
The programmed death ligand 1 (PDL1)/programmed death 1 (PD1) costimulatory pathway plays an important role in the inhibition of alloimmune responses as well as in the induction and maintenance of peripheral tolerance. It has been demonstrated recently that PDL1 also

Nasz zespół naukowców ma doświadczenie we wszystkich obszarach badań, w tym w naukach przyrodniczych, materiałoznawstwie, syntezie chemicznej, chromatografii, analityce i wielu innych dziedzinach.

Skontaktuj się z zespołem ds. pomocy technicznej