Skip to Content
Merck
All Photos(5)

Documents

Safety Information

AMAB90627

Sigma-Aldrich

Monoclonal Anti-HER2 antibody produced in mouse

Prestige Antibodies® Powered by Atlas Antibodies, clone CL0268, purified immunoglobulin, buffered aqueous glycerol solution

Synonym(s):

Anti Her2 Antibody, Anti Her2 Antibody - Monoclonal Anti-HER2 antibody produced in mouse, CD340, HER-2, HER2, NEU, NGL

Sign Into View Organizational & Contract Pricing


About This Item

UNSPSC Code:
12352203
NACRES:
NA.41

biological source

mouse

conjugate

unconjugated

antibody form

purified immunoglobulin

antibody product type

primary antibodies

clone

CL0268, monoclonal

product line

Prestige Antibodies® Powered by Atlas Antibodies

form

buffered aqueous glycerol solution

species reactivity

human

technique(s)

immunoblotting: 1 μg/mL
immunohistochemistry: 1:50- 1:200

isotype

IgG1

Ensembl | human accession no.

application(s)

research pathology

shipped in

wet ice

storage temp.

−20°C

target post-translational modification

unmodified

Gene Information

human ... HER2(2064)

General description

Human epidermal growth factor receptor 2 (HER2), also known as Erb-b2 receptor tyrosine kinase 2 (ErbB2), is encoded by the gene mapped to human chromosome 17. The encoded protein is a member of epidermal growth factor family. HER2 membrane protein is characterized with a cysteine-rich extracellular ligand-binding domain, a hydrophobic membrane spanning region and an intracellular tyrosine kinase domain.This protein does not have a ligand., It either forms heterodimers with other family members or homodimer with itself, when expressed at very high levels, to get activated. HER2 is expressed at low level in normal tissues, but at high level in breast cancer tissues.

Immunogen

V-erb-b2 erythroblastic leukemia viral oncogene homolog 2, neuro/glioblastoma derived oncogene homolog (avian) recombinant protein epitope signature tag (PrEST)

Application

All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the industry. The Human Protein Atlas project can be subdivided into three efforts: Human Tissue Atlas, Cancer Atlas, and Human Cell Atlas. The antibodies that have been generated in support of the Tissue and Cancer Atlas projects have been tested by immunohistochemistry against hundreds of normal and disease tissues and through the recent efforts of the Human Cell Atlas project, many have been characterized by immunofluorescence to map the human proteome not only at the tissue level but now at the subcellular level. These images and the collecation of this vast data set can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. We also provide Prestige Antibodies® protocols and other useful information.

Monoclonal Anti-HER2 antibody produced in mouse has been used in Western blotting.
Applications in which this antibody has been used successfully, and the associated peer-reviewed papers, are given below.
Western Blotting (1 paper)

Biochem/physiol Actions

Human epidermal growth factor receptor 2 (HER2) signaling pathway promotes cell proliferation and survival in majority of breast cancers. Thus, overexpression of this protein leads to breast cancer. Heterodimeric complex of HER2 and phosphatidylinositide 3-kinase (PI3K) is the most potent stimulator of the phosphatidylinositol-3-kinase (PI3K)/Akt anti-apoptosis pathway. Upregulated expression of HER2 is associated with the development of ovarian, colorectal, pancreatic, endometrial and gastric cancers. Trastuzumab, an antibody, works by binding to a domain in the external domain of HER2. This domain is missing in p95, a truncated form of HER2, and hence these cancer cells show resistance to trastuzumab. HER2 protein can be used as a prognostic marker and as a therapeutic option for gynecologic cancers.

Features and Benefits

Prestige Antibodies® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.

Every Prestige Antibody is tested in the following ways:
  • IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
  • Protein array of 364 human recombinant protein fragments.

Sequence

YNTDTFESMPNPEGRYTFGASCVTACPYNYLSTDVGSCTLVCPLHNQEVTAEDGTQRCEKCSKPCARVCYGLGMEHLREVRAVTSANIQEFAGCKKIFGSLAFLPESFDGDPASNTAPLQPEQLQVFGAPHR

Linkage

Corresponding Antigen APREST93786

Physical form

Phospate buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide

Legal Information

Prestige Antibodies is a registered trademark of Merck KGaA, Darmstadt, Germany

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Not finding the right product?  

Try our Product Selector Tool.

Storage Class Code

10 - Combustible liquids

WGK

WGK 1


Regulatory Listings

Regulatory Listings are mainly provided for chemical products. Only limited information can be provided here for non-chemical products. No entry means none of the components are listed. It is the user’s obligation to ensure the safe and legal use of the product.

JAN Code

AMAB90627-100UL:
AMAB90627-25UL:


Certificates of Analysis (COA)

Search for Certificates of Analysis (COA) by entering the products Lot/Batch Number. Lot and Batch Numbers can be found on a product’s label following the words ‘Lot’ or ‘Batch’.

Already Own This Product?

Find documentation for the products that you have recently purchased in the Document Library.

Visit the Document Library

Christiane Stiller et al.
Bioconjugate chemistry, 30(11), 2790-2798 (2019-10-15)
Antibody-DNA conjugates are powerful tools for DNA-assisted protein analysis. Growing usage of these methods demands efficient production of high-quality conjugates. We developed an easy and fast synthesis route yielding covalent antibody-DNA conjugates with a defined conjugation site and low batch-to-batch
Inga Newie et al.
Scientific reports, 6, 35664-35664 (2016-10-19)
We previously reported that the human HER2 gene encodes the intronic microRNA mir-4728, which is overexpressed together with its oncogenic host gene and may act independently of the HER2 receptor. More recently, we also reported that the oncogenic miR-21-5p is
HER2 expression beyond breast cancer: therapeutic implications for gynecologic malignancies.
English DP, et al.
Molecular Diagnosis & Therapy, 17(2), 85-99 (2013)
The role of p95HER2 in trastuzumab resistance in breast cancer.
Ozkavruk Eliyatkin N, et al.
Journal of B.U.ON. : Official Journal of the Balkan Union of Oncology, 21(2), 382-389 (2016)
HER2: biology, detection, and clinical implications.
Gutierrez C and Schiff R.
Archives of Pathology & Laboratory Medicine, 135(1), 55-62 (2011)

Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.

Contact Technical Service