AV32784

Anti-ACSL1 (AB1) antibody produced in rabbit

affinity isolated antibody

• Sinonimo/i: Anti-ACS1, Anti-Acyl-CoA synthetase long-chain family member 1, Anti-FACL1, Anti-FACL2, Anti-LACS, Anti-LACS1, Anti-LACS2
• Codice UNSPSC: 12352203
• NACRES: NA.41

Proprietà

• Origine biologica: rabbit
• Livello qualitativo: 100
• Coniugato: unconjugated
• Forma dell’anticorpo: affinity isolated antibody
• Tipo di anticorpo: primary antibodies
• Clone: polyclonal
• Forma fisica: buffered aqueous solution
• PM: 78 kDa
• Reattività contro le specie: human, mouse, rat
• Concentrazione: 0.5 mg - 1 mg/mL
• tecniche: immunohistochemistry: suitable; western blot: suitable
• N° accesso NCBI: NP_001986
• N° accesso UniProt: P33121
• Condizioni di spedizione: wet ice
• Temperatura di conservazione: −20°C
• modifica post-traduzionali bersaglio: unmodified
• Informazioni sul gene: human ... ACSL1(2180)

Descrizione

Descrizione generale

ACSL1 is an isozyme that belongs to the long-chain fatty-acid-coenzyme A ligase family. This enzyme converts free long-chain fatty acids into fatty acyl-CoA esters. Thus, it regulates lipid synthesis and fatty acid breakdown. Studies in bovine mammary glands have reported that ACSL1 modulates the channelling of fatty acids towards milk fat formation.
Rabbit Anti-ACSL1 (AB1) antibody recognizes pig, bovine, zebrafish, human, mouse, rat, and canine ACSL1.

Immunogeno

Synthetic peptide directed towards the C terminal region of human ACSL1

Applicazioni

Rabbit Anti-ACSL1 (AB1) antibody can be used for western blot applications at a concentration of 1 μg/ml.

Azioni biochim/fisiol

ACSL1 encodes an isozyme of the long-chain fatty-acid-coenzyme A ligase family. Although differing in substrate specificity, subcellular localization, and tissue distribution, all isozymes of this family convert free long-chain fatty acids into fatty acyl-CoA esters, and thereby play a key role in lipid biosynthesis and fatty acid degradation.The protein encoded by this gene is an isozyme of the long-chain fatty-acid-coenzyme A ligase family. Although differing in substrate specificity, subcellular localization, and tissue distribution, all isozymes of this family convert free long-chain fatty acids into fatty acyl-CoA esters, and thereby play a key role in lipid biosynthesis and fatty acid degradation. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.

Sequenza

Synthetic peptide located within the following region: GSFEELCRNKDVKKAILEDMVRLGKDSGLKPFEQVKGITLHPELFSIDNG

Stato fisico

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Esclusione di responsabilità

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Informazioni sulla sicurezza

• Codice della classe di stoccaggio: 10 - Combustible liquids
• Classe di pericolosità dell'acqua (WGK): WGK 3
• Punto d’infiammabilità (°F): Not applicable
• Punto d’infiammabilità (°C): Not applicable