AV35418

Anti-CHRNA7 (AB1) antibody produced in rabbit

IgG fraction of antiserum

• Sinonimo/i: Anti-Cholinergic receptor, nicotinic, α 7
• Codice UNSPSC: 12352203
• NACRES: NA.41

Proprietà

• Origine biologica: rabbit
• Livello qualitativo: 100
• Coniugato: unconjugated
• Forma dell’anticorpo: IgG fraction of antiserum
• Tipo di anticorpo: primary antibodies
• Clone: polyclonal
• Forma fisica: buffered aqueous solution
• PM: 56 kDa
• Reattività contro le specie: human, horse, guinea pig, rabbit, bovine
• Concentrazione: 0.5 mg - 1 mg/mL
• tecniche: western blot: suitable
• N° accesso NCBI: XP_001717927
• N° accesso UniProt: P36544
• Condizioni di spedizione: wet ice
• Temperatura di conservazione: −20°C
• modifica post-traduzionali bersaglio: unmodified
• Informazioni sul gene: human ... CHRNA7(89832)

Descrizione

Descrizione generale

Neuronal acetylcholine receptor subunit α-7 (CHRNA7 or NACHRA7) is a subunit of a member of the nicotinic acetylcholine receptor family. These proteins are hetero-pentamers composed of homologous subunits. Upon acetylcholine binding the receptor undergoes a conformational change resulting in an open ion channel. CHRNA7 is found highly expressed in the hippocampus localized to GABAergic neurons.

Immunogeno

Synthetic peptide directed towards the middle region of human CHRNA7

Azioni biochim/fisiol

The protein encoded by CHRNA7 displays marked permeability to calcium ions and is a major component of brain nicotinic receptors that are blocked by, and highly sensitive to, alpha-bungarotoxin. Once this receptor binds acetylcholine, it undergoes an extensive change in conformation that affects all subunits and leads to opening of an ion-conducting channel across the plasma membrane. This gene is located in a region identified as a major susceptibility locus for juvenile myoclonic epilepsy and a chromosomal location involved in the genetic transmission of schizophrenia.

Sequenza

Synthetic peptide located within the following region: VPTPDSGVVCGRMACSPTHDEHLLHGGQPPEGDPDLAKILEEVRYIANRF

Stato fisico

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Esclusione di responsabilità

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Informazioni sulla sicurezza

• Codice della classe di stoccaggio: 10 - Combustible liquids
• Classe di pericolosità dell'acqua (WGK): WGK 3
• Punto d’infiammabilità (°F): Not applicable
• Punto d’infiammabilità (°C): Not applicable