AV48116

Anti-SLC14A1 antibody produced in rabbit

affinity isolated antibody

• Sinónimos: Anti-FLJ33745, Anti-FLJ41687, Anti-HUT11, Anti-HsT1341, Anti-JK, Anti-RACH1, Anti-Solute carrier family 14 (urea transporter), member 1 (Kidd blood group), Anti-UT-B1
• Código UNSPSC: 12352203
• NACRES: NA.41

Propiedades

• origen biológico: rabbit
• Nivel de calidad: 100
• conjugado: unconjugated
• forma del anticuerpo: affinity isolated antibody
• tipo de anticuerpo: primary antibodies
• clon: polyclonal
• formulario: buffered aqueous solution
• mol peso: 42 kDa
• reactividad de especies: human
• concentración: 0.5 mg - 1 mg/mL
• técnicas: immunohistochemistry: suitable; western blot: suitable
• Nº de acceso NCBI: NP_001122060
• Nº de acceso UniProt: Q13336
• Condiciones de envío: wet ice
• temp. de almacenamiento: −20°C
• modificación del objetivo postraduccional: unmodified
• Información sobre el gen: human ... SLC14A1(6563)

Descripción

Descripción general

SLC14A1 codes for a protein that belongs to the solute carrier family. It facilitates the transport of urea in red blood cells and also forms the basis of the Kidd blood grouping system. SLC14A1 has been identified as a susceptibility locus for bladder cancer.
Rabbit Anti-SLC14A1 antibody recognizes human, canine, bovine, and mouse SLC14A1.

Inmunógeno

Synthetic peptide directed towards the C terminal region of human SLC14A1

Aplicación

Rabbit Anti-SLC14A1 antibody is suitable for western blot applications at a concentration of western blot at a concentration of 0.25 μg/ml and for IHC at 4-8 μg/ml.

Acciones bioquímicas o fisiológicas

SLC14A1 is a specialized low-affinity urea transporter. It mediates urea transport in erythrocytes.

Secuencia

Synthetic peptide located within the following region: LSSPLMCLHAAIGSLLGIAAGLSLSAPFENIYFGLWGFNSSLACIAMGGM

Forma física

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Cláusula de descargo de responsabilidad

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Información de seguridad

• Código de clase de almacenamiento: 10 - Combustible liquids
• Clase de riesgo para el agua (WGK): WGK 3
• Punto de inflamabilidad (°F): Not applicable
• Punto de inflamabilidad (°C): Not applicable