Passa al contenuto
Merck
Tutte le immagini(2)

Documenti fondamentali

WH0007442M1

Sigma-Aldrich

Monoclonal Anti-TRPV1 antibody produced in mouse

clone 1F5, purified immunoglobulin, buffered aqueous solution

Sinonimo/i:

Trpv1 Antibody, Trpv1 Antibody - Monoclonal Anti-TRPV1 antibody produced in mouse, Anti-DKFZp434K0220, Anti-VR1, Anti-transient receptor potential cation channel, subfamily V, member 1

Autenticatiper visualizzare i prezzi riservati alla tua organizzazione & contrattuali


About This Item

Numero MDL:
Codice UNSPSC:
12352203
NACRES:
NA.41

Origine biologica

mouse

Livello qualitativo

Coniugato

unconjugated

Forma dell’anticorpo

purified immunoglobulin

Tipo di anticorpo

primary antibodies

Clone

1F5, monoclonal

Stato

buffered aqueous solution

Reattività contro le specie

human

tecniche

indirect ELISA: suitable
western blot: 1-5 μg/mL

Isotipo

IgG1κ

N° accesso Genebanck

N° accesso UniProt

Condizioni di spedizione

dry ice

Temperatura di conservazione

−20°C

modifica post-traduzionali bersaglio

unmodified

Informazioni sul gene

human ... TRPV1(7442)

Descrizione generale

The gene encoding transient receptor potential cation channel subfamily V member 1 (TRPV1) is mapped to human chromosome 17p13. It is a non-selective cation channel. The protein is expressed on airway nerve fibers. It is also strongly expressed in sensory neurons.

Immunogeno

TRPV1 (NP_542437, 21 a.a. ~ 124 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
CPDPLDGDPNSRPPPAKPQLSTAKSRTRLFGKGDSEEAFPVDCPHEEGELDSCPTITVSPVITIQRPGDGPTGARLLSQDSVAASTEKTLRLYDRRSIFEAVAQ

Azioni biochim/fisiol

Transient receptor potential cation channel subfamily V member 1 (TRPV1) is a capsaicin receptor. It participates in pain perception. TRPV1 also modulates afferent signals and bronchoconstriction. In the brain, it regulates neuronal function, motor behaviour and neuroinflammation. Capsaicin plays an important role in the activation of TRPV1.

Stato fisico

Solution in phosphate buffered saline, pH 7.4

Note legali

GenBank is a registered trademark of United States Department of Health and Human Services

Esclusione di responsabilità

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Non trovi il prodotto giusto?  

Prova il nostro Motore di ricerca dei prodotti.

Codice della classe di stoccaggio

10 - Combustible liquids

Punto d’infiammabilità (°F)

Not applicable

Punto d’infiammabilità (°C)

Not applicable

Dispositivi di protezione individuale

Eyeshields, Gloves, multi-purpose combination respirator cartridge (US)


Scegli una delle versioni più recenti:

Certificati d'analisi (COA)

Lot/Batch Number

Non trovi la versione di tuo interesse?

Se hai bisogno di una versione specifica, puoi cercare il certificato tramite il numero di lotto.

Possiedi già questo prodotto?

I documenti relativi ai prodotti acquistati recentemente sono disponibili nell’Archivio dei documenti.

Visita l’Archivio dei documenti

I clienti hanno visto anche

The 57 kb deletion in cystinosis patients extends into TRPV1 causing dysregulation of transcription in peripheral blood mononuclear cells.
Freed KA
Journal of medical Genetics (2011)
Role of transient receptor potential vanilloid 1 in the modulation of airway smooth muscle tone and calcium handling.
Yocum GT
American Journal of Physiology. Lung Cellular and Molecular Physiology (2017)
TRPV1 on astrocytes rescues nigral dopamine neurons in Parkinson's disease via CNTF.
Nam JH
Brain (2015)
S Christopher Hiett et al.
Cardiovascular research, 103(4), 607-618 (2014-06-18)
The TRPV1, transient receptor potential vanilloid type 1, agonist capsaicin is considered to be beneficial for cardiovascular health because it dilates coronary arteries through an endothelial-dependent mechanism and may slow atheroma progression. However, recent reports indicate that high doses of
Mohammed Shaqura et al.
Neuropharmacology, 85, 142-150 (2014-05-28)
Painful diabetic neuropathy is a disease of the peripheral sensory neuron with impaired opioid responsiveness. Since μ-opioid receptor (MOR) activation can inhibit the transient receptor potential vanilloid 1 (TRPV1) activity in peripherally sensory neurons, this study investigated the mechanisms of

Il team dei nostri ricercatori vanta grande esperienza in tutte le aree della ricerca quali Life Science, scienza dei materiali, sintesi chimica, cromatografia, discipline analitiche, ecc..

Contatta l'Assistenza Tecnica.