Passa al contenuto
Merck
Tutte le immagini(4)

Documenti fondamentali

WH0000632M1

Sigma-Aldrich

Monoclonal Anti-BGLAP antibody produced in mouse

clone 2D4, purified immunoglobulin, buffered aqueous solution

Sinonimo/i:

Anti-BGP, Anti-bone gamma-carboxyglutamate (gla) protein (osteocalcin)

Autenticatiper visualizzare i prezzi riservati alla tua organizzazione & contrattuali
Tutte le immagini(4)

About This Item

Numero MDL:
MFCD00162722
Codice UNSPSC:
12352203
NACRES:
NA.41

Origine biologica

mouse

Livello qualitativo

100

Coniugato

unconjugated

Forma dell’anticorpo

purified immunoglobulin

Tipo di anticorpo

primary antibodies

Clone

2D4, monoclonal

Stato

buffered aqueous solution

Reattività contro le specie

human

tecniche

immunofluorescence: suitable
indirect ELISA: suitable
western blot: 1-5 μg/mL

Isotipo

IgG1λ

N° accesso Genebanck

NM_199173

N° accesso UniProt

P02818

Condizioni di spedizione

dry ice

Temperatura di conservazione

−20°C

modifica post-traduzionali bersaglio

unmodified

Informazioni sul gene

human ... BGLAP(632)

Immunogeno

BGLAP (NP_954642, 52 a.a. ~ 100 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
YLYQWLGAPVPYPDPLEPRREVCELNPDCDELADHIGFQEAYRRFYGPV

Caratteristiche e vantaggi

Evaluate our antibodies with complete peace of mind. If the antibody does not perform in your application, we will issue a full credit or replacement antibody. Learn more.

Stato fisico

Solution in phosphate buffered saline, pH 7.4

Note legali

GenBank is a registered trademark of United States Department of Health and Human Services

Esclusione di responsabilità

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Non trovi il prodotto giusto?  

Prova il nostro Motore di ricerca dei prodotti.

Raccomandato

N° Catalogo
Descrizione
Determinazione del prezzo

Codice della classe di stoccaggio

10 - Combustible liquids

Punto d’infiammabilità (°F)

Not applicable

Punto d’infiammabilità (°C)

Not applicable

Dispositivi di protezione individuale

Eyeshields, Gloves, multi-purpose combination respirator cartridge (US)

Scegli una delle versioni più recenti:

Certificati d'analisi (COA)

Lot/Batch Number
D3291-2D4
08280-2D4
08337-2D4
08183-2D4

Non trovi la versione di tuo interesse?

Se hai bisogno di una versione specifica, puoi cercare il certificato tramite il numero di lotto.

Cerca un COA

Possiedi già questo prodotto?

I documenti relativi ai prodotti acquistati recentemente sono disponibili nell’Archivio dei documenti.

Visita l’Archivio dei documenti

R-L Huang et al.
Osteoarthritis and cartilage, 22(8), 1186-1196 (2014-07-02)
Numerous recent reports have observed a low osteoinductive efficacy property of bone morphogenetic protein-2 (BMP-2) and disappointing long-term outcomes in clinical cases. An alternative hypothesis, that these observations are caused by an exaggerated inflammatory environment, needs experimental evidence. Thirty-seven Sprague
J Javier Aguilera et al.
Biochimie, 104, 70-80 (2014-06-01)
Serum amyloid A (SAA) is an apolipoprotein involved in poorly understood roles in inflammation. Upon trauma, hepatic expression of SAA rises 1000 times the basal levels. In the case of inflammatory diseases like rheumatoid arthritis, there is a risk for
Moustafa Sayed et al.
Stem cell research, 13(1), 12-23 (2014-05-06)
Endogenous ligands of Na/K-ATPase have been demonstrated to increase in kidney dysfunction and heart failure. It is also reported that Na/K-ATPase signaling function effects stem cell differentiation. This study evaluated whether Na/K-ATPase activation through its ligands and associated signaling functions
Yingjian Jiang et al.
Journal of interferon & cytokine research : the official journal of the International Society for Interferon and Cytokine Research, 34(7), 518-525 (2014-04-12)
Tight junctions (TJs) are the structural basis for the intestinal epithelium barrier. Increased intestinal permeability caused by variations in TJ proteins may result in bacterial translocation (BT). There is increasing evidence that BT might contribute to the occurrence and development
Frank Schwarz et al.
Clinical oral investigations, 18(6), 1679-1686 (2013-11-26)
This study seeks to assess and compare immunohistochemical characteristics of regenerated and pristine bone areas following surgical therapy of advanced peri-implantitis. At ligature-induced peri-implantitis defects, the intrabony component was filled with a natural bone mineral (NBM), and the supracrestal component
Visualizza tutti i documenti correlati

Il team dei nostri ricercatori vanta grande esperienza in tutte le aree della ricerca quali Life Science, scienza dei materiali, sintesi chimica, cromatografia, discipline analitiche, ecc..

Contatta l'Assistenza Tecnica.