SAB2108661

Anti-FFAR1

affinity isolated antibody

• Codice UNSPSC: 12352203
• NACRES: NA.41

Proprietà

• Origine biologica: rabbit
• Livello qualitativo: 100
• Coniugato: unconjugated
• Forma dell’anticorpo: affinity isolated antibody
• Tipo di anticorpo: primary antibodies
• Clone: polyclonal
• Forma fisica: buffered aqueous solution
• PM: 31 kDa
• Reattività contro le specie: bovine, human, dog
• Concentrazione: 0.5-1 mg/mL
• tecniche: immunoblotting: suitable
• Numero d’accesso: NM_005303
• N° accesso UniProt: O14842
• Condizioni di spedizione: wet ice
• Temperatura di conservazione: −20°C
• modifica post-traduzionali bersaglio: unmodified
• Informazioni sul gene: human ... FFAR1(2864)

Descrizione

Descrizione generale

Free fatty acid receptor 1 (FFAR1) formerly known as G-protein coupled receptor 40 (GPR 40) is predominantly expressed in pancreatic beta cells. In human chromosome, the gene FFAR1 is located on 19q13.12.

Immunogeno

Synthetic peptide directed towards the N terminal region of human FFAR1

Azioni biochim/fisiol

Free fatty acid receptor 1 (FFAR1) is activated by binding of medium or long chain free fatty acids. It increases the Ca²⁺ level intracellularly through phospholipase C mediated signalling and that potentially stimulates insulin production. FFAR1 is a potential drug target for metabolic diseases like type 2 diabetes.

Sequenza

Synthetic peptide located within the following region: KVSEAALSLLVLILIITSASRSQPKVPEWVNTPSTCCLKYYEKVLPRRLV

Stato fisico

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Esclusione di responsabilità

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Informazioni sulla sicurezza

• Codice della classe di stoccaggio: 10 - Combustible liquids
• Classe di pericolosità dell'acqua (WGK): WGK 3
• Punto d’infiammabilità (°F): Not applicable
• Punto d’infiammabilità (°C): Not applicable