Passa al contenuto
Merck
Tutte le immagini(13)

Documenti fondamentali

AMAB90988

Sigma-Aldrich

Monoclonal Anti-PDIA3 antibody produced in mouse

enhanced validation

Prestige Antibodies® Powered by Atlas Antibodies, clone CL2444, purified immunoglobulin, buffered aqueous glycerol solution

Sinonimo/i:

Monoclonal Anti-ERp57, Monoclonal Anti-ERp60, Monoclonal Anti-ERp61, Monoclonal Anti-GRP57, Monoclonal Anti-GRP58, Monoclonal Anti-HsT17083, Monoclonal Anti-P58, Monoclonal Anti-PI-PLC

Autenticatiper visualizzare i prezzi riservati alla tua organizzazione & contrattuali


About This Item

Codice UNSPSC:
12352203
NACRES:
NA.41

Origine biologica

mouse

Livello qualitativo

Coniugato

unconjugated

Forma dell’anticorpo

purified immunoglobulin

Tipo di anticorpo

primary antibodies

Clone

CL2444, monoclonal

Nome Commerciale

Prestige Antibodies® Powered by Atlas Antibodies

Stato

buffered aqueous glycerol solution

Reattività contro le specie

human

Convalida avanzata

RNAi knockdown
orthogonal RNAseq
Learn more about Antibody Enhanced Validation

tecniche

immunoblotting: 1 μg/mL
immunofluorescence: 2-10 μg/mL
immunohistochemistry: 1:5000- 1:10000

Isotipo

IgG1

Sequenza immunogenica

PTLKIFRDGEEAGAYDGPRTADGIVSHLKKQAGPASVPLRTEEEFKKFISDKDASIVGFFDDSFSEAHSEFLKAASNLRDNYRFAHTNVESLVNEYDDNGEGIILFRPSHLTNKFEDK

N° accesso UniProt

Condizioni di spedizione

wet ice

Temperatura di conservazione

−20°C

modifica post-traduzionali bersaglio

unmodified

Informazioni sul gene

human ... PDIA3(2923)

Descrizione generale

Monoclonal Anti-PDIA3 Prestige Antibodies® Powered by Atlas Antibodies is developed and validated by the Human Protein Atlas (HPA) project . Each antibody is tested by immunohistochemistry against hundreds of normal and
PDIA3 (protein disulfide isomerase family A member 3) is also known as ERp57. It is present in the cytoplasm, nucleus and endoplasmic reticulum. ERp57 is a constituent of the multimeric spermatozoa-zona pellucida (ZP) receptor complex. This gene is located on human chromosome 15q15.

Immunogeno

Protein disulfide isomerase family A, member 3

Applicazioni

All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the industry.

The Human Protein Atlas project can be subdivided into three efforts: Human Tissue Atlas, Cancer Atlas, and Human Cell Atlas. The antibodies that have been generated in support of the Tissue and Cancer Atlas projects have been tested by immunohistochemistry against hundreds of normal and disease tissues and through the recent efforts of the Human Cell Atlas project, many have been characterized by immunofluorescence to map the human proteome not only at the tissue level but now at the subcellular level. These images and the collection of this vast data set can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. We also provide Prestige Antibodies® protocols and other useful information.
Monoclonal Anti-PDIA3 antibody has been used in immunofluorescence.

Azioni biochim/fisiol

PDIA3 (protein disulfide isomerase family A member 3) participates in virus induced endoplasmic reticulum stress (ERS). It plays a major role in tumorigenesis. ERp57 is involved in the generation of major histocompatibility complex class I (MHC I) to impact the immunogenicity of tumor cells. It also regulates the thiol-disulphide status of proteins. PDIA3 is linked with several diseases like, cancer, prion disorders, Alzheimer′s disease and Parkinson′s diseases.

Caratteristiche e vantaggi

Evaluate our antibodies with complete peace of mind. If the antibody does not perform in your application, we will issue a full credit or replacement antibody. Learn more.
Prestige Antibodies® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.

Every Prestige Antibody is tested in the following ways:
  • IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
  • Protein array of 364 human recombinant protein fragments.

Linkage

Corresponding Antigen APREST86567

Stato fisico

Phospate buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide

Note legali

Prestige Antibodies is a registered trademark of Merck KGaA, Darmstadt, Germany

Esclusione di responsabilità

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Non trovi il prodotto giusto?  

Prova il nostro Motore di ricerca dei prodotti.

Codice della classe di stoccaggio

10 - Combustible liquids

Classe di pericolosità dell'acqua (WGK)

WGK 1


Scegli una delle versioni più recenti:

Certificati d'analisi (COA)

Lot/Batch Number

Non trovi la versione di tuo interesse?

Se hai bisogno di una versione specifica, puoi cercare il certificato tramite il numero di lotto.

Possiedi già questo prodotto?

I documenti relativi ai prodotti acquistati recentemente sono disponibili nell’Archivio dei documenti.

Visita l’Archivio dei documenti

Increased ERp57 Expression in HBV-Related Hepatocellular Carcinoma: Possible Correlation and Prognosis.
Miao L, et al.
BioMed Research International, 2017, 1252647-1252647 (2017)
Expression profiles of subtracted mRNAs during cellular senescence in human mesenchymal stem cells derived from bone marrow.
Jung KY, et al.
Experimental Gerontology, 48(5), 464-471 (2013)
The roles of protein disulphide isomerase family A, member 3 (ERp57) and surface thiol/disulphide exchange in human spermatozoa-zona pellucida binding.
Wong CW, et al.
Human Reproduction, 32(4), 733-742 (2017)
Salinomycin kills cancer stem cells by sequestering iron in lysosomes.
Mai TT, et al.
Nature Chemistry, 9, 1025?1033-1025?1033 (2017)
Comparative Analysis of the Interaction between Different Flavonoids and PDIA3.
Giamogante F, et al.
Oxidative Medicine and Cellular Longevity, 2016, 4518281-4518281 (2016)

Global Trade Item Number

SKUGTIN
AMAB90988-25UL4061841686934
AMAB90988-100UL4061837048777

Il team dei nostri ricercatori vanta grande esperienza in tutte le aree della ricerca quali Life Science, scienza dei materiali, sintesi chimica, cromatografia, discipline analitiche, ecc..

Contatta l'Assistenza Tecnica.