Passa al contenuto
Merck
Tutte le immagini(4)

Documenti fondamentali

SAB2100658

Sigma-Aldrich

Anti-EIF2AK1 antibody produced in rabbit

affinity isolated antibody

Sinonimo/i:

Anti-Eukaryotic translation initiation factor 2-α kinase 1, Anti-HRI, Anti-KIAA1369

Autenticatiper visualizzare i prezzi riservati alla tua organizzazione & contrattuali


About This Item

Numero MDL:
Codice UNSPSC:
12352203
NACRES:
NA.41

Origine biologica

rabbit

Livello qualitativo

Coniugato

unconjugated

Forma dell’anticorpo

affinity isolated antibody

Tipo di anticorpo

primary antibodies

Clone

polyclonal

Stato

buffered aqueous solution

PM

71 kDa

Reattività contro le specie

dog, guinea pig, horse, human, mouse, rabbit, rat, bovine

Concentrazione

0.5 mg - 1 mg/mL

tecniche

immunohistochemistry: suitable
western blot: suitable

N° accesso UniProt

Condizioni di spedizione

wet ice

Temperatura di conservazione

−20°C

modifica post-traduzionali bersaglio

unmodified

Informazioni sul gene

human ... EIF2AK1(27102)

Immunogeno

Synthetic peptide directed towards the N terminal region of human EIF2AK1

Azioni biochim/fisiol

EIF2AK1 acts at the level of translation initiation to downregulate protein synthesis in response to stress. The protein is a kinase that can be inactivated by hemin. Two transcript variants encoding different isoforms have been found for this gene.The HRI gene is localized to 7p22 where its 3′ end slightly overlaps the 3′ end of the gene JTV1. The two genes are transcribed from opposite strands. Studies in rat and rabbit suggest that the HRI gene product phosphorylates the alpha subunit of eukaryotic initiation factor 2. Its kinase activity is induced by low levels of heme and inhibited by the presence of heme. Sequence Note: The sequence AF181071.1 is a chimeric mRNA clone. Only the heme-regulated initiation factor 2-alpha kinase region was propagated into this RefSeq record.

Sequenza

Synthetic peptide located within the following region: TCSDEFSSLRLHHNRAITHLMRSAKERVRQDPCEDISRIQKIRSREVALE

Stato fisico

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Esclusione di responsabilità

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Non trovi il prodotto giusto?  

Prova il nostro Motore di ricerca dei prodotti.

Codice della classe di stoccaggio

10 - Combustible liquids

Classe di pericolosità dell'acqua (WGK)

WGK 3

Punto d’infiammabilità (°F)

Not applicable

Punto d’infiammabilità (°C)

Not applicable


Scegli una delle versioni più recenti:

Certificati d'analisi (COA)

Lot/Batch Number

Non trovi la versione di tuo interesse?

Se hai bisogno di una versione specifica, puoi cercare il certificato tramite il numero di lotto.

Possiedi già questo prodotto?

I documenti relativi ai prodotti acquistati recentemente sono disponibili nell’Archivio dei documenti.

Visita l’Archivio dei documenti

Il team dei nostri ricercatori vanta grande esperienza in tutte le aree della ricerca quali Life Science, scienza dei materiali, sintesi chimica, cromatografia, discipline analitiche, ecc..

Contatta l'Assistenza Tecnica.