MSST0015

SILu^™Prot B2M beta-2-microglobulin human

recombinant, expressed in HEK 293 cells, SIL MS Protein Standard, ¹³C- and ¹⁵N-labeled

• Sinonimo/i: β-2-microglobulin
• Codice UNSPSC: 23201100
• NACRES: NA.12

Proprietà

• Origine biologica: human
• Livello qualitativo: 200
• Ricombinante: expressed in HEK 293 cells
• Saggio: ≥98% (SDS-PAGE)
• Forma fisica: lyophilized powder
• Potenza: ≥98% Heavy amino acids incorporation efficiency by MS
• tecniche: mass spectrometry (MS): suitable
• Compatibilità: suitable for mass spectrometry (standard)
• N° accesso UniProt: P61769
• Temperatura di conservazione: −20°C
• Informazioni sul gene: human ... B2M(567)

Descrizione

Descrizione generale

SILu^™ Prot B2M is a recombinant, stable isotope-labeled human B2M which incorporates [¹³C₆, ¹⁵N₄]-Arginine and [¹³C₆, ¹⁵N₂]-Lysine. Expressed in human 293 cells, it is designed to be used as an internal standard for bioanalysis of B2M in mass-spectrometry. SILu^™ Prot B2M is a monomer of 119 amino acids (including C-terminal polyhistidine and flag tags), with a molecular weight of ~14 kDa.
Suggested Quantitative Analysis Parameters
(MRM settings provided for three suggested peptides)

Azioni biochim/fisiol

B2M is the light chain of the major histocompatibility class (MHC) I molecule expressed on the cell surface of all nucleated cells. Increased urinary B2M excretion has been observed to be an early marker of tubular injury in a number of settings, including nephrotoxicant exposure, cardiac surgery, and renal transplantation, preceding rises in serum creatinine by as many as 4−5 days. B2M may also serve as an early biomarker for AKI (Acute Kidney Injury).

Sequenza

IQRTPKIQVYSRHPAENGKSNFLNCYVSGFHPSDIEVDLLKNGERIEKVEHSDLSFSKDWSFYLLYYTEFTPTEKDEYACRVNHVTLSQPKIVKWDRDMDYKDDDDKGHHHHHHHHGGQ

Stato fisico

Supplied as a lyophilized powder containing phosphate buffered saline.

Note legali

SILu is a trademark of Sigma-Aldrich Co. LLC

Informazioni sulla sicurezza

• Codice della classe di stoccaggio: 11 - Combustible Solids
• Classe di pericolosità dell'acqua (WGK): WGK 2
• Punto d’infiammabilità (°F): Not applicable
• Punto d’infiammabilità (°C): Not applicable