HPA007884

Anti-ABCA3 antibody produced in rabbit

Prestige Antibodies^® Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution

• Sinonimo/i: Anti-ABC-C transporter antibody produced in rabbit, Anti-ATP-binding cassette 3 antibody produced in rabbit, Anti-ATP-binding cassette sub-family A member 3 antibody produced in rabbit, Anti-ATP-binding cassette transporter 3 antibody produced in rabbit
• Codice UNSPSC: 12352203
• Numero Human Protein Atlas: HPA007884
• NACRES: NA.41

Proprietà

• Origine biologica: rabbit
• Livello qualitativo: 100
• Coniugato: unconjugated
• Forma dell’anticorpo: affinity isolated antibody
• Tipo di anticorpo: primary antibodies
• Clone: polyclonal
• Nome Commerciale: Prestige Antibodies^® Powered by Atlas Antibodies
• Stato: buffered aqueous glycerol solution
• Reattività contro le specie: human
• Convalida avanzata: orthogonal RNAseq; Learn more about Antibody Enhanced Validation
• tecniche: immunofluorescence: 0.25-2 μg/mL; immunohistochemistry: 1:50-1:200
• Sequenza immunogenica: MLRLTLGEYGRTVVPFSVPGTSQLGQQLSEHLKDALQAEGQEPREVLGDLEEFLIFRASVEGGGFNERCLVAASFRDVGERTVVNALFNNQAYHSPATALAVVDNLLFKLLCGPHASIVVSNFPQPRSALQAAKDQFNEG
• N° accesso UniProt: Q99758
• Condizioni di spedizione: wet ice
• Temperatura di conservazione: −20°C
• modifica post-traduzionali bersaglio: unmodified
• Informazioni sul gene: human ... ABCA3(21)

Descrizione

Descrizione generale

ABCA3 (ATP-binding cassette, sub-family A, member3) gene encodes a member of the ABCA subclass of ATP-binding cassette (ABC) transporters. Its expression is restricted to lungs in the type II cells expressing surfactant protein A. Its expression is up-regulated by glucocorticoids just before birth.

Immunogeno

ATP-binding cassette sub-family A member 3 recombinant protein epitope signature tag (PrEST)

Applicazioni

Anti-ABCA3 antibody produced in rabbit, a Prestige Antibody, is developed and validated by the Human Protein Atlas (HPA) project . Each antibody is tested by immunohistochemistry against hundreds of normal and disease tissues. These images can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. The antibodies are also tested using immunofluorescence and western blotting. To view these protocols and other useful information about Prestige Antibodies and the HPA, visit sigma.com/prestige.

Azioni biochim/fisiol

ABCA3 (ATP-binding cassette, sub-family A, member3) gene encodes a member of the ABC1 subfamily and is mainly localized to the limiting membrane of the lamellar bodies in human lung. It functions in the transmembrane transport of lipid components of pulmonary surfactant. It is involved in the metabolism of pulmonary surfactant lipids and in the biogenesis of lamellar body. Mutations in this gene are associated with fatal surfactant deficiency in neonates resulting in lethal respiratory distress and interstitial lung disease.

Caratteristiche e vantaggi

Prestige Antibodies^® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies^® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.

Every Prestige Antibody is tested in the following ways:

• IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
• Protein array of 364 human recombinant protein fragments.

Linkage

Corresponding Antigen APREST86886

Stato fisico

Solution in phosphate-buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide

Note legali

Prestige Antibodies is a registered trademark of Merck KGaA, Darmstadt, Germany

Esclusione di responsabilità

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Informazioni sulla sicurezza

• Codice della classe di stoccaggio: 10 - Combustible liquids
• Classe di pericolosità dell'acqua (WGK): WGK 1
• Punto d’infiammabilità (°F): Not applicable
• Punto d’infiammabilità (°C): Not applicable
• Dispositivi di protezione individuale: Eyeshields, Gloves, multi-purpose combination respirator cartridge (US)