Passa al contenuto
Merck
Tutte le immagini(1)

Documenti fondamentali

AV49979

Sigma-Aldrich

Anti-UNC93B1 antibody produced in rabbit

IgG fraction of antiserum

Sinonimo/i:

Anti-MGC126617, Anti-UNC93, Anti-UNC93B, Anti-Unc-93 homolog B1 (C. elegans)

Autenticatiper visualizzare i prezzi riservati alla tua organizzazione & contrattuali
Tutte le immagini(1)

About This Item

Codice UNSPSC:
12352203
NACRES:
NA.41

Origine biologica

rabbit

Livello qualitativo

100

Coniugato

unconjugated

Forma dell’anticorpo

IgG fraction of antiserum

Tipo di anticorpo

primary antibodies

Clone

polyclonal

Stato

buffered aqueous solution

PM

67 kDa

Reattività contro le specie

bovine, horse, mouse, guinea pig, human, dog, rat

Concentrazione

0.5 mg - 1 mg/mL

tecniche

western blot: suitable

N° accesso NCBI

NP_112192

N° accesso UniProt

Q9H1C4

Condizioni di spedizione

wet ice

Temperatura di conservazione

−20°C

modifica post-traduzionali bersaglio

unmodified

Informazioni sul gene

human ... UNC93B1(81622)

Immunogeno

Synthetic peptide directed towards the N terminal region of human UNC93B1

Applicazioni

Anti-UNC93B1 antibody produced in rabbit is suitable for western blotting at a concentration of 5.0μg/ml.

Azioni biochim/fisiol

Unc-93 homolog B1 (UNC93B1) is a transmembrane protein localized to the plasma membrane. It is involved in the trafficking of nucleic acid-sensing toll-like receptors (TLR) from endoplasmic reticulum to the endolysosomes. It regulates both innate and adaptive immune responses by regulating TLR signaling.

Sequenza

Synthetic peptide located within the following region: LKNVLAASAGGMLTYGVYLGLLQMQLILHYDETYREVKYGNMGLPDIDSK

Stato fisico

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Esclusione di responsabilità

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Non trovi il prodotto giusto?  

Prova il nostro Motore di ricerca dei prodotti.

Codice della classe di stoccaggio

10 - Combustible liquids

Classe di pericolosità dell'acqua (WGK)

WGK 3

Punto d’infiammabilità (°F)

Not applicable

Punto d’infiammabilità (°C)

Not applicable

Scegli una delle versioni più recenti:

Certificati d'analisi (COA)

Lot/Batch Number

Non trovi la versione di tuo interesse?

Se hai bisogno di una versione specifica, puoi cercare il certificato tramite il numero di lotto.

Cerca un COA

Possiedi già questo prodotto?

I documenti relativi ai prodotti acquistati recentemente sono disponibili nell’Archivio dei documenti.

Visita l’Archivio dei documenti

Bettina L Lee et al.
eLife, 2, e00291-e00291 (2013-02-22)
UNC93B1, a multipass transmembrane protein required for TLR3, TLR7, TLR9, TLR11, TLR12, and TLR13 function, controls trafficking of TLRs from the endoplasmic reticulum (ER) to endolysosomes. The mechanisms by which UNC93B1 mediates these regulatory effects remain unclear. Here, we demonstrate
Bruno Luiz Fonseca Schamber-Reis et al.
The Journal of biological chemistry, 288(10), 7127-7136 (2013-01-18)
The mammalian homolog B1 of Unc-93 Caenorhabditis elegans known as UNC93B1 is a chaperone protein that mediates translocation of the nucleic acid-sensing Toll-like receptors (TLRs) from the endoplasmic reticulum to the endolysosomes. The triple deficient (UNC93B1 mutant) mice have a
Jelka Pohar et al.
PloS one, 9(3), e92391-e92391 (2014-03-22)
Toll-like receptor 3 (TLR3) is a dsRNA sensing receptor that is localized in the cellular compartments but also at the plasma membrane. Overexpression of UNC93B1 promoted localization of TLR3, but not other nucleic acid sensing TLRs, to the plasma membrane.
Rongsu Qi et al.
The Journal of biological chemistry, 285(47), 36635-36644 (2010-09-22)
The innate immune receptor Toll-like receptor 3 (TLR3) can be present on the surface of the plasma membranes of cells and in endolysosomes. The Unc93b1 protein has been reported to facilitate localization of TLR7 and 9 and is required for

Il team dei nostri ricercatori vanta grande esperienza in tutte le aree della ricerca quali Life Science, scienza dei materiali, sintesi chimica, cromatografia, discipline analitiche, ecc..

Contatta l'Assistenza Tecnica.