Pular para o conteúdo
Merck
Todas as fotos(4)

Documentos Principais

WH0057761M3

Sigma-Aldrich

Monoclonal Anti-TRIB3 antibody produced in mouse

clone 1H2, purified immunoglobulin, buffered aqueous solution

Sinônimo(s):

Anti-C20orf97, Anti-NIPK, Anti-SINK, Anti-SKIP3, Anti-TRB3, Anti-tribbles homolog 3 (Drosophila)

Faça loginpara ver os preços organizacionais e de contrato
Todas as fotos(4)

About This Item

Número MDL:
MFCD08705525
Código UNSPSC:
12352203
NACRES:
NA.41

fonte biológica

mouse

Nível de qualidade

100

conjugado

unconjugated

forma do anticorpo

purified immunoglobulin

tipo de produto de anticorpo

primary antibodies

clone

1H2, monoclonal

forma

buffered aqueous solution

reatividade de espécies

human

técnica(s)

indirect ELISA: suitable
indirect immunofluorescence: suitable
western blot: 1-5 μg/mL

Isotipo

IgG1κ

nº de adesão GenBank

BC027484

nº de adesão UniProt

Q96RU7

Condições de expedição

dry ice

temperatura de armazenamento

−20°C

modificação pós-traducional do alvo

unmodified

Informações sobre genes

human ... TRIB3(57761)

Descrição geral

The protein encoded by this gene is a putative protein kinase that is induced by the transcription factor NF-kappaB. The encoded protein is a negative regulator of NF-kappaB and can also sensitize cells to TNF- and TRAIL-induced apoptosis. In addition, this protein can negatively regulate the cell survival serine-threonine kinase AKT1. (provided by RefSeq)

Imunogênio

TRIB3 (AAH27484, 56 a.a. ~ 145 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
PDRATAVATASRLGPYVLLEPEEGGRAYRALHCPTGTEYTCKVYPVQEALAVLEPYARLPPHKHVARPTEVLAGTQLLYAFFTRTHGDMH

forma física

Solution in phosphate buffered saline, pH 7.4

Informações legais

GenBank is a registered trademark of United States Department of Health and Human Services

Não está encontrando o produto certo?  

Experimente o nosso Ferramenta de seleção de produtos.

Código de classe de armazenamento

10 - Combustible liquids

Classe de risco de água (WGK)

nwg

Ponto de fulgor (°F)

Not applicable

Ponto de fulgor (°C)

Not applicable

Equipamento de proteção individual

Eyeshields, Gloves, multi-purpose combination respirator cartridge (US)

Certificados de análise (COA)

Busque Certificados de análise (COA) digitando o Número do Lote do produto. Os números de lote e remessa podem ser encontrados no rótulo de um produto após a palavra “Lot” ou “Batch”.

Já possui este produto?

Encontre a documentação dos produtos que você adquiriu recentemente na biblioteca de documentos.

Visite a Biblioteca de Documentos

Pan Zhu et al.
Cell death & disease, 8(12), 3207-3207 (2017-12-15)
The Helicobacter pylori vacuolating cytotoxin (VacA) can promote progressive vacuolation and gastric injury and may be associated with human gastric cancer. Increasing evidence indicates that autophagy is involved in the cell death induced by VacA, but the specific mechanisms need
Michaela D Filiou et al.
Journal of psychiatric research, 58, 115-122 (2014-08-16)
No comprehensive metabolic profile of trait anxiety is to date available. To identify metabolic biosignatures for different anxiety states, we compared mice selectively inbred for ∼ 40 generations for high (HAB), normal (NAB) or low (LAB) anxiety-related behavior. Using a
Devora Champa et al.
Endocrine-related cancer, 21(5), 755-767 (2014-07-12)
Poorly differentiated tumors of the thyroid gland (PDTC) are generally characterized by a poor prognosis due to their resistance to available therapeutic approaches. The relative rarity of these tumors is a major obstacle to our understanding of the molecular mechanisms
Weiwei Wang et al.
Diabetes research and clinical practice, 106(1), 101-109 (2014-08-13)
Fibrosis is the final disorder of most chronic kidney disease including diabetic nephropathy (DN), but the mechanisms are not fully understood. The present study aims to determine whether TRB3 participates in fibrogenesis in DN. Type1 diabetes was induced in male
Gisela Campos et al.
Archives of toxicology, 88(6), 1267-1280 (2014-04-22)
Since xenobiotics enter the organism via the liver, hepatocytes must cope with numerous perturbations, including modifications of proteins leading to endoplasmic reticulum stress (ER-stress). This triggers a signaling pathway termed unfolded protein response (UPR) that aims to restore homeostasis or

Nossa equipe de cientistas tem experiência em todas as áreas de pesquisa, incluindo Life Sciences, ciência de materiais, síntese química, cromatografia, química analítica e muitas outras.

Entre em contato com a assistência técnica