Pular para o conteúdo
Merck
Todas as fotos(4)

Documentos Principais

WH0010397M3

Sigma-Aldrich

Monoclonal Anti-NDRG1 antibody produced in mouse

clone 2D7, purified immunoglobulin, buffered aqueous solution

Sinônimo(s):

Anti-CAP43, Anti-CMT4D, Anti-DRG1, Anti-GC4, Anti-HMSNL, Anti-N-myc downstream regulated gene 1, Anti-NDR1, Anti-NMSL, Anti-PROXY1, Anti-RIT42, Anti-RTP, Anti-TARG1, Anti-TDD5

Faça loginpara ver os preços organizacionais e de contrato


About This Item

Número MDL:
Código UNSPSC:
12352203
NACRES:
NA.41

fonte biológica

mouse

conjugado

unconjugated

forma do anticorpo

purified immunoglobulin

tipo de produto de anticorpo

primary antibodies

clone

2D7, monoclonal

Formulário

buffered aqueous solution

reatividade de espécies

human

técnica(s)

immunofluorescence: suitable
immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable
indirect ELISA: suitable
western blot: 1-5 μg/mL

Isotipo

IgG2aκ

nº de adesão GenBank

nº de adesão UniProt

Condições de expedição

dry ice

temperatura de armazenamento

−20°C

modificação pós-traducional do alvo

unmodified

Informações sobre genes

human ... NDRG1(10397)

Categorias relacionadas

Descrição geral

This gene is a member of the N-myc downregulated gene family which belongs to the alpha/beta hydrolase superfamily. The protein encoded by this gene is a cytoplasmic protein involved in stress responses, hormone responses, cell growth, and differentiation. It is necessary for p53-mediated caspase activation and apoptosis. Mutation in this gene has been reported to be causative for hereditary motor and sensory neuropathy-Lom. Multiple alternatively spliced variants, encoding the same protein, have been identified. (provided by RefSeq)

Imunogênio

NDRG1 (AAH03175, 1 a.a. ~ 394 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
MSREMQDVDLAEVKPLVEKGETITGLLQEFDVQEQDIETLHGSVHVTLCGTPKGNRPVILTYHDIGMNHKTCYNPLFNYEDMQEITQHFAVCHVDAPGQQDGAASFPAGYMYPSMDQLAEMLPGVLQQFGLKSIIGMGTGAGAYILTRFALNNPEMVEGLVLINVNPCAEGWMDWAASKISGWTQALPDMVVSHLFGKEEMQSNVEVVHTYRQHIVNDMNPGNLHLFINAYNSRRDLEIERPMPGTHTVTLQCPALLVVGDSSPAVDAVVECNSKLDPTKTTLLKMADCGGLPQISQPAKLAEAFKYFVQGMGYMPSASMTRLMRSRTASGSSVTSLDGTRSRSHTSEGTRSRSHTSEGTRSRSHTSEGAHLDITPNSGAAGNSAGPKSMEVSC

Aplicação

Monoclonal Anti-NDRG1 antibody produced in mouse has been used in immunohistochemistry and Western blotting.

Ações bioquímicas/fisiológicas

NDRG1 (N-myc downstream regulated 1) is a Rab4a (Ras-related protein Rab-4A) effector protein associated with cell proliferation, differentiation, and invasion. It localizes at the perinuclear recycling/sorting vesicles of trans Golgi network. NDRG1 is essentially required for the p53-dependent apoptosis. At the site of DNA damage, its elevated expression identifies the target genes required for mediating apoptosis. It also plays a major role in the recycling and stabilization of adhesion molecule E-cadherin. In endosome recycling, NDRG1 interacts with the membrane bound Rab4aGTPase. Reports show that NDRG1 acts as a biomarker in the development of colorectal cancer (CRC).

forma física

Solution in phosphate buffered saline, pH 7.4

Informações legais

GenBank is a registered trademark of United States Department of Health and Human Services

Exoneração de responsabilidade

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Não está encontrando o produto certo?  

Experimente o nosso Ferramenta de seleção de produtos.

Código de classe de armazenamento

10 - Combustible liquids

Ponto de fulgor (°F)

Not applicable

Ponto de fulgor (°C)

Not applicable

Equipamento de proteção individual

Eyeshields, Gloves, multi-purpose combination respirator cartridge (US)


Escolha uma das versões mais recentes:

Certificados de análise (COA)

Lot/Batch Number

Não está vendo a versão correta?

Se precisar de uma versão específica, você pode procurar um certificado específico pelo número do lote ou da remessa.

Já possui este produto?

Encontre a documentação dos produtos que você adquiriu recentemente na biblioteca de documentos.

Visite a Biblioteca de Documentos

N-myc downstream-regulated gene 1 promotes apoptosis in colorectal cancer via up-regulating death receptor 4
Oncotarget, 8(47), 82593?82608-82593?82608 (2017)
The metastasis suppressor, N-myc downregulated gene 1 (NDRG1), is a prognostic biomarker for human colorectal cancer
Zhihai Mao
PLoS ONE, 8 (2013)
Xiao Yang et al.
Oncotarget, 8(29), 47709-47724 (2017-05-26)
N-myc downstream-regulated gene1 (NDRG1) has been identified as a potent tumor suppressor gene. The molecular mechanisms of anti-tumor activity of NDRG1 involve its suppressive effects on a variety of tumorigenic signaling pathways. The purpose of this study was to investigate
NDRG1 is necessary for p53-dependent apoptosis
The Journal of Biological Chemistry, 279 (2004)
N-myc downstream-regulated gene 1 promotes oxaliplatin-triggered apoptosis in colorectal cancer cells via enhancing the ubiquitination of Bcl-2
Xiao Yang
Oncotarget (2017)

Nossa equipe de cientistas tem experiência em todas as áreas de pesquisa, incluindo Life Sciences, ciência de materiais, síntese química, cromatografia, química analítica e muitas outras.

Entre em contato com a assistência técnica