Pular para o conteúdo
Merck
Todas as fotos(5)

Documentos Principais

WH0007153M1

Sigma-Aldrich

Monoclonal Anti-TOP2A antibody produced in mouse

clone 1E2, purified immunoglobulin, buffered aqueous solution

Sinônimo(s):

Anti-TOP2, Anti-TP2A, Anti-topoisomerase (DNA) II alpha 170kDa

Faça loginpara ver os preços organizacionais e de contrato


About This Item

Código UNSPSC:
12352203
NACRES:
NA.41

fonte biológica

mouse

Nível de qualidade

conjugado

unconjugated

forma do anticorpo

purified immunoglobulin

tipo de produto de anticorpo

primary antibodies

clone

1E2, monoclonal

Formulário

buffered aqueous solution

reatividade de espécies

human

técnica(s)

immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable
indirect ELISA: suitable
indirect immunofluorescence: suitable
western blot: 1-5 μg/mL

Isotipo

IgG1κ

nº de adesão GenBank

nº de adesão UniProt

Condições de expedição

dry ice

temperatura de armazenamento

−20°C

modificação pós-traducional do alvo

unmodified

Informações sobre genes

human ... TOP2A(7153)

Descrição geral

This gene encodes a DNA topoisomerase, an enzyme that controls and alters the topologic states of DNA during transcription. This nuclear enzyme is involved in processes such as chromosome condensation, chromatid separation, and the relief of torsional stress that occurs during DNA transcription and replication. It catalyzes the transient breaking and rejoining of two strands of duplex DNA which allows the strands to pass through one another, thus altering the topology of DNA. Two forms of this enzyme exist as likely products of a gene duplication event. The gene encoding this form, alpha, is localized to chromsome 17 and the beta gene is localized to chromosome 3. The gene encoding this enzyme functions as the target for several anticancer agents and a variety of mutations in this gene have been associated with the development of drug resistance. Reduced activity of this enzyme may also play a role in ataxia-telangiectasia. (provided by RefSeq)

Imunogênio

TOP2A (NP_001058, 1435 a.a. ~ 1531 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
RAAPKGTKRDPALNSGVSQKPDPAKTKNRRKRKPSTSDDSDSNFEKIVSKAVTSKKSKGESDDFHMDFDSAVAPRAKSVRAKKPIKYLEESDEDDLF

Ações bioquímicas/fisiológicas

Topoisomerase II A (TOP2A) enzyme plays a vital role in DNA replication and cell proliferation. Experimental studies show an increased expression of this enzyme in Chinese patients with gastric carcinoma. DNA topoisomerase 2-α acts as a target enzyme for an anthracycline drug called as epirubicin and many other antineoplastic drugs. Top2α is involved in reducing the topological stress in cells. The hsa-miR-485-3p downregulates the expression of nuclear transcription factor Y subunit β (NFYB), which acts as a mediator of Top2α. Consequently, it decreases the expression of Top2α and its drug responsiveness. Top2α enzyme plays an important role in maintenance of chromosome condensation and segregation. Ataxia telangiectasia mutated (ATM)-dependent regulation of TOP2A helps in TOP2 stability and also it′s sensitivity to TOP2 inhibitor.

forma física

Solution in phosphate buffered saline, pH 7.4

Informações legais

GenBank is a registered trademark of United States Department of Health and Human Services

Exoneração de responsabilidade

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Não está encontrando o produto certo?  

Experimente o nosso Ferramenta de seleção de produtos.

Código de classe de armazenamento

10 - Combustible liquids

Ponto de fulgor (°F)

Not applicable

Ponto de fulgor (°C)

Not applicable

Equipamento de proteção individual

Eyeshields, Gloves, multi-purpose combination respirator cartridge (US)


Escolha uma das versões mais recentes:

Certificados de análise (COA)

Lot/Batch Number

Não está vendo a versão correta?

Se precisar de uma versão específica, você pode procurar um certificado específico pelo número do lote ou da remessa.

Já possui este produto?

Encontre a documentação dos produtos que você adquiriu recentemente na biblioteca de documentos.

Visite a Biblioteca de Documentos

Novel regulation of nuclear factor-YB by miR-485-3p affects the expression of DNA topoisomerase IIa and drug responsiveness.
Chen CF
Molecular Pharmacology, 79(4), 735-741 (2011)
RECQL5 cooperates with Topoisomerase II alpha in DNA decatenation and cell cycle progression.
Ramamoorthy M
Nucleic Acids Research, 40(4), 1621-1635 (2012)
The transcriptional regulator Aire binds to and activates super-enhancers.
Bansal K
Nature Immunology, 18(3), 263-273 (2017)
Kushagra Bansal et al.
Nature immunology, 18(3), 263-273 (2017-01-31)
Aire is a transcription factor that controls T cell tolerance by inducing the expression of a large repertoire of genes specifically in thymic stromal cells. It interacts with scores of protein partners of diverse functional classes. We found that Aire
Analysis of EGFR, HER2, and TOP2A gene status and chromosomal polysomy in gastric adenocarcinoma from Chinese patients.
Liang Z
BMC Cancer, 8, 363-363 (2008)

Nossa equipe de cientistas tem experiência em todas as áreas de pesquisa, incluindo Life Sciences, ciência de materiais, síntese química, cromatografia, química analítica e muitas outras.

Entre em contato com a assistência técnica