WH0007124M2

Monoclonal Anti-TNF antibody produced in mouse

clone 1C3-A1-F4, purified immunoglobulin, buffered aqueous solution

• Sinônimo(s): Anti-DIF, Anti-TNFA, Anti-TNFSF2, Anti-TNFalpha, Anti-tumor necrosis factor (TNF superfamily, member 2)
• Número MDL: MFCD00162116
• Código UNSPSC: 12352203
• NACRES: NA.43

Propriedades

• fonte biológica: mouse
• conjugado: unconjugated
• forma do anticorpo: purified immunoglobulin
• tipo de produto de anticorpo: primary antibodies
• clone: 1C3-A1-F4, monoclonal
• forma: buffered aqueous solution
• reatividade de espécies: human
• técnica(s): indirect ELISA: suitable; western blot: 1-5 μg/mL
• Isotipo: IgG1κ
• nº de adesão GenBank: BC028148
• nº de adesão UniProt: P01375
• Condições de expedição: dry ice
• temperatura de armazenamento: −20°C
• modificação pós-traducional do alvo: unmodified
• Informações sobre genes: human ... TNF(7124)

Descrição

Descrição geral

This gene encodes a multifunctional proinflammatory cytokine that belongs to the tumor necrosis factor (TNF) superfamily. This cytokine is mainly secreted by macrophages. It can bind to, and thus functions through its receptors TNFRSF1A/TNFR1 and TNFRSF1B/TNFBR. This cytokine is involved in the regulation of a wide spectrum of biological processes including cell proliferation, differentiation, apoptosis, lipid metabolism, and coagulation. This cytokine has been implicated in a variety of diseases, including autoimmune diseases, insulin resistance, and cancer. Knockout studies in mice also suggested the neuroprotective function of this cytokine. (provided by RefSeq)

Tumor necrosis factor-alpha (TNF-α) is a homotrimeric proinflammatory cytokine. This gene is located on human chromosome 6. It is a glial-cell related factor. TNF-α belongs to the TNF (tumor necrosis factor) family.

Imunogênio

TNF (AAH28148, 1 a.a. ~ 233 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
MSTESMIRDVELAEEALPKKTGGPQGSRRCLFLSLFSFLIVAGATTLFCLLHFGVIGPQREEFPRDLSLISPLAQAVRSSSRTPSDKPVAHVVANPQAEGQLQWLNRRANALLANGVELRDNQLVVPSEGLYLIYSQVLFKGQGCPSTHVLLTHTISRIAVSYQTKVNLLSAIKSPCQRETPEGAEAKPWYEPIYLGGVFQLEKGDRLSAEINRPDYLDFAESGQVYFGIIAL

Ações bioquímicas/fisiológicas

Tumor necrosis factor-alpha (TNF-α) is important in the host immune response to infection. It act as a mediator in severe periportal fibrosis (PPF). TNF-α stimulates apoptosis. This cytokine is linked with the pathogenesis of many autoimmune and inflammatory diseases.

forma física

Solution in phosphate buffered saline, pH 7.4

Informações legais

GenBank is a registered trademark of United States Department of Health and Human Services

Exoneração de responsabilidade

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Informações de segurança

• Código de classe de armazenamento: 10 - Combustible liquids
• Ponto de fulgor (°F): Not applicable
• Ponto de fulgor (°C): Not applicable
• Equipamento de proteção individual: Eyeshields, Gloves, multi-purpose combination respirator cartridge (US)