Pular para o conteúdo
Merck
Todas as fotos(3)

Documentos Principais

WH0007124M2

Sigma-Aldrich

Monoclonal Anti-TNF antibody produced in mouse

clone 1C3-A1-F4, purified immunoglobulin, buffered aqueous solution

Sinônimo(s):

Anti-DIF, Anti-TNFA, Anti-TNFSF2, Anti-TNFalpha, Anti-tumor necrosis factor (TNF superfamily, member 2)

Faça loginpara ver os preços organizacionais e de contrato


About This Item

Número MDL:
Código UNSPSC:
12352203
NACRES:
NA.43

fonte biológica

mouse

Nível de qualidade

conjugado

unconjugated

forma do anticorpo

purified immunoglobulin

tipo de produto de anticorpo

primary antibodies

clone

1C3-A1-F4, monoclonal

Formulário

buffered aqueous solution

reatividade de espécies

human

técnica(s)

indirect ELISA: suitable
western blot: 1-5 μg/mL

Isotipo

IgG1κ

nº de adesão GenBank

nº de adesão UniProt

Condições de expedição

dry ice

temperatura de armazenamento

−20°C

modificação pós-traducional do alvo

unmodified

Informações sobre genes

human ... TNF(7124)

Descrição geral

This gene encodes a multifunctional proinflammatory cytokine that belongs to the tumor necrosis factor (TNF) superfamily. This cytokine is mainly secreted by macrophages. It can bind to, and thus functions through its receptors TNFRSF1A/TNFR1 and TNFRSF1B/TNFBR. This cytokine is involved in the regulation of a wide spectrum of biological processes including cell proliferation, differentiation, apoptosis, lipid metabolism, and coagulation. This cytokine has been implicated in a variety of diseases, including autoimmune diseases, insulin resistance, and cancer. Knockout studies in mice also suggested the neuroprotective function of this cytokine. (provided by RefSeq)
Tumor necrosis factor-alpha (TNF-α) is a homotrimeric proinflammatory cytokine. This gene is located on human chromosome 6. It is a glial-cell related factor. TNF-α belongs to the TNF (tumor necrosis factor) family.

Imunogênio

TNF (AAH28148, 1 a.a. ~ 233 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
MSTESMIRDVELAEEALPKKTGGPQGSRRCLFLSLFSFLIVAGATTLFCLLHFGVIGPQREEFPRDLSLISPLAQAVRSSSRTPSDKPVAHVVANPQAEGQLQWLNRRANALLANGVELRDNQLVVPSEGLYLIYSQVLFKGQGCPSTHVLLTHTISRIAVSYQTKVNLLSAIKSPCQRETPEGAEAKPWYEPIYLGGVFQLEKGDRLSAEINRPDYLDFAESGQVYFGIIAL

Ações bioquímicas/fisiológicas

Tumor necrosis factor-alpha (TNF-α) is important in the host immune response to infection. It act as a mediator in severe periportal fibrosis (PPF). TNF-α stimulates apoptosis. This cytokine is linked with the pathogenesis of many autoimmune and inflammatory diseases.

forma física

Solution in phosphate buffered saline, pH 7.4

Informações legais

GenBank is a registered trademark of United States Department of Health and Human Services

Exoneração de responsabilidade

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Não está encontrando o produto certo?  

Experimente o nosso Ferramenta de seleção de produtos.

Código de classe de armazenamento

10 - Combustible liquids

Ponto de fulgor (°F)

Not applicable

Ponto de fulgor (°C)

Not applicable

Equipamento de proteção individual

Eyeshields, Gloves, multi-purpose combination respirator cartridge (US)


Escolha uma das versões mais recentes:

Certificados de análise (COA)

Lot/Batch Number

Não está vendo a versão correta?

Se precisar de uma versão específica, você pode procurar um certificado específico pelo número do lote ou da remessa.

Já possui este produto?

Encontre a documentação dos produtos que você adquiriu recentemente na biblioteca de documentos.

Visite a Biblioteca de Documentos

TNF-alpha Inhibitors (2006)
Influence of a TNF-? Polymorphism on the Severity of Schistosomiasis Periportal Fibrosis in the Northeast of Brazil
Silva PCV, et al.
Genetic Testing and Molecular Biomarkers, 21(11), 658-662 (2017)
Association between TNF-?-238G/A gene polymorphism and OCD susceptibility: A meta-analysis
Jiang C, et al.
Medicine (2018)
Tumor necrosis factor-alpha (TNF-alpha) increases both in the brain and in the cerebrospinal fluid from parkinsonian patients
Mogi M, et al.
Neuroscience Letters, 165(1-2), 208-210 (1994)
K M Reich et al.
Alimentary pharmacology & therapeutics, 40(6), 629-638 (2014-07-22)
Medical therapy is standard treatment for ulcerative colitis with colectomy reserved for medically refractory disease or malignancy. The introductions of ciclosporin in 1994 and anti-TNF therapy in 2005 have extended medical management options. To determine whether the colectomy incidence rate

Global Trade Item Number

SKUGTIN
WH0007124M2-100UG4061832743578

Nossa equipe de cientistas tem experiência em todas as áreas de pesquisa, incluindo Life Sciences, ciência de materiais, síntese química, cromatografia, química analítica e muitas outras.

Entre em contato com a assistência técnica