Pular para o conteúdo
Merck
Todas as fotos(5)

Documentos Principais

WH0004950M1

Sigma-Aldrich

Monoclonal Anti-OCLN antibody produced in mouse

clone 1G7, purified immunoglobulin, buffered aqueous solution

Sinônimo(s):

Anti-occludin

Faça loginpara ver os preços organizacionais e de contrato
Todas as fotos(5)

About This Item

Número MDL:
MFCD00803885
Código UNSPSC:
12352203
NACRES:
NA.41

fonte biológica

mouse

Nível de qualidade

100

conjugado

unconjugated

forma do anticorpo

purified immunoglobulin

tipo de produto de anticorpo

primary antibodies

clone

1G7, monoclonal

Formulário

buffered aqueous solution

reatividade de espécies

human

técnica(s)

immunoprecipitation (IP): suitable
indirect ELISA: suitable
indirect immunofluorescence: suitable
western blot: 1-5 μg/mL

Isotipo

IgG1κ

nº de adesão GenBank

NM_002538

nº de adesão UniProt

Q16625

Condições de expedição

dry ice

temperatura de armazenamento

−20°C

modificação pós-traducional do alvo

unmodified

Informações sobre genes

human ... OCLN(4950)

Categorias relacionadas

Descrição geral

This gene encodes an integral membrane protein which is located at tight junctions. This protein may be involved in the formation and maintenance of the tight junction. The possibility of several alternatively spliced products has been suggested but the full nature of these products has not been described. (provided by RefSeq)

Imunogênio

OCLN (NP_002529, 423 a.a. ~ 522 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
ITSDQQRQLYKRNFDTGLQEYKSLQSELDEINKELSRLDKELDDYREESEEYMAAADEYNRLKQVKGSADYKSKKNHCKQLKSKLSHIKKMVGDYDRQKT

forma física

Solution in phosphate buffered saline, pH 7.4

Informações legais

GenBank is a registered trademark of United States Department of Health and Human Services

Exoneração de responsabilidade

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Não está encontrando o produto certo?  

Experimente o nosso Ferramenta de seleção de produtos.

recomendado

Nº do produto
Descrição
Preços

Código de classe de armazenamento

10 - Combustible liquids

Ponto de fulgor (°F)

Not applicable

Ponto de fulgor (°C)

Not applicable

Equipamento de proteção individual

Eyeshields, Gloves, multi-purpose combination respirator cartridge (US)

Escolha uma das versões mais recentes:

Certificados de análise (COA)

Lot/Batch Number
09300-1G7
09041-1G7
06146-1G7

Não está vendo a versão correta?

Se precisar de uma versão específica, você pode procurar um certificado específico pelo número do lote ou da remessa.

Pesquise por COA

Já possui este produto?

Encontre a documentação dos produtos que você adquiriu recentemente na biblioteca de documentos.

Visite a Biblioteca de Documentos

Outi Huttala et al.
ALTEX, 32(2), 125-136 (2015-03-06)
The formation of blood vessels is a vital process in embryonic development and in normal physiology. Current vascular modelling is mainly based on animal biology leading to species-to-species variation when extrapolating the results to humans. Although there are a few
Mei Chin Lee et al.
Investigative ophthalmology & visual science, 55(6), 3833-3841 (2014-05-08)
The role of the recently identified primary angle closure glaucoma (PACG) susceptibility gene, pleckstrin homology domain containing, family A member 7 (PLEKHA7), in PACG is unknown. PLEKHA7 associates with apical junctional complexes (AJCs) and is thus implicated in paracellular fluid
Yingli Jing et al.
Chinese medical journal, 127(15), 2808-2813 (2014-08-26)
Pericytes, located on microvessels, help to maintain vascular stability and blood-brain barrier integrity. The influence of pericytes on microvessels after spinal cord injury (SCI) is less clear. Therefore, the aim of this study was to investigate whether pericytes took a
Ziqing Liu et al.
Journal of neurovirology, 20(3), 278-293 (2014-03-29)
Hepatitis C virus (HCV) infection causes the central nervous system (CNS) abnormalities in more than 50 % of chronically infected subjects. However, the underlying mechanisms are largely unknown. In this study, we characterized the HCV interactions with astrocytes, one of the
Xiaodong Zheng et al.
Investigative ophthalmology & visual science, 55(6), 3454-3460 (2014-05-02)
To compare the efficacy of three types of ocular lubricants in protecting corneal epithelial cells in dry eye animal models. Ocular lubricants containing 0.1% or 0.3% sodium hyaluronate (SH), carboxymethylcellulose (CMC), or hydroxypropyl methylcellulose (HPMC) were tested. First, ocular lubricant
Exibir todos os documentos relacionados

Global Trade Item Number

SKUGTIN
WH0004950M1-100UG4061831634921

Nossa equipe de cientistas tem experiência em todas as áreas de pesquisa, incluindo Life Sciences, ciência de materiais, síntese química, cromatografia, química analítica e muitas outras.

Entre em contato com a assistência técnica