WH0004435M1

Monoclonal Anti-CITED1 antibody produced in mouse

clone 6G8, purified immunoglobulin, buffered aqueous solution

• Sinônimo(s): Anti-Cbp/p300-interacting transactivator, with Glu/Asp-rich carboxy-terminal domain, 1, Anti-MSG1
• Código UNSPSC: 12352203
• NACRES: NA.41

Propriedades

• fonte biológica: mouse
• Nível de qualidade: 100
• conjugado: unconjugated
• forma do anticorpo: purified immunoglobulin
• tipo de produto de anticorpo: primary antibodies
• clone: 6G8, monoclonal
• forma: buffered aqueous solution
• reatividade de espécies: human, rat, mouse
• técnica(s): indirect ELISA: suitable; western blot: 1-5 μg/mL
• Isotipo: IgG2aκ
• nº de adesão GenBank: NM_004143
• nº de adesão UniProt: Q99966
• Condições de expedição: dry ice
• temperatura de armazenamento: −20°C
• modificação pós-traducional do alvo: unmodified
• Informações sobre genes: human ... CITED1(4435)

Descrição

Descrição geral

CITED1 (Cbp/p300 interacting transactivator with Glu/Asp rich carboxy-terminal domain 1)/MSG1 (melanocyte-specific gene 1) is a non-DNA binding transcriptional co-activator. It has a smad-4 interacting domain (SID) and a conserved region 2 (CR2) domain. This gene codes for a 27 kDa protein that belongs to the CITED (CBP/p300-interacting transactivators with glutamic acid [E] and aspartic acid [D]-rich C-terminal domain) family of nuclear proteins. CITED1 is located on human chromosome Xq13.

This gene encodes a member of the CREB-binding protein/p300-interacting transactivator with Asp/Glu-rich C-terminal domain (CITED) family of proteins. The encoded protein, also known as melanocyte-specific gene 1, may function as a transcriptional coactivator and may play a role in pigmentation of melanocytes. Alternatively spliced transcript variants have been described. (provided by RefSeq)

Imunogênio

CITED1 (NP_004134, 94 a.a. ~ 193 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
SMQLQKLNSQYQGMAAATPGQPGEAGPLQNWDFGAQAGGAESLSPSAGAQSPAIIDSDPVDEEVLMSLVVELGLDRANELPELWLGQNEFDFTADFPSSC

Ações bioquímicas/fisiológicas

CITED1 (Cbp/p300 interacting transactivator with Glu/Asp rich carboxy-terminal domain 1)/MSG1 (melanocyte-specific gene 1) controls cellular activities of the metanephric mesenchyme. This gene is linked to papillary thyroid carcinoma. MSG1 is involved in pigmentation. It also participates in malignant transformation of pigment cells.

forma física

Solution in phosphate buffered saline, pH 7.4

Informações legais

GenBank is a registered trademark of United States Department of Health and Human Services

Exoneração de responsabilidade

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Informações de segurança

• Código de classe de armazenamento: 10 - Combustible liquids
• Ponto de fulgor (°F): Not applicable
• Ponto de fulgor (°C): Not applicable
• Equipamento de proteção individual: Eyeshields, Gloves, multi-purpose combination respirator cartridge (US)