SAB5702191

Anti-SynGAP Antibody, clone 8M2S9, Rabbit Monoclonal

• Sinônimo(s): MRD5, RASA1, RASA5, SYNGAP
• Código UNSPSC: 12352203
• NACRES: NA.46
• clone: 8M2S9, monoclonal
• application: WB
• reatividade de espécies: rat, human, rat
• técnica(s): western blot: 1:500 - 1:2000

Propriedades

• fonte biológica: rabbit
• Nível de qualidade: 100
• Materiais: colorless
• clone: 8M2S9, monoclonal
• Formulário: liquid
• peso molecular: 140 kDa
• reatividade de espécies: rat, human, rat
• concentração: 0.70 mg/mL
• técnica(s): western blot: 1:500 - 1:2000
• cor: colorless
• Isotipo: IgG
• sequência de imunogênio: SEKRLRQQQAEKDSQIKSIIGRLMLVEEELRRDHPAMAEPLPEPKKRLLDAQERQLPPLGPTNPRVTLAPPWNGLAPPAPPPPPRLQITENGEFRNTADH
• nº de adesão UniProt: Q96PV0
• Condições de expedição: wet ice
• temperatura de armazenamento: −20°C
• modificação pós-traducional do alvo: unmodified
• Informações sobre genes: human ... SYNGAP1(8831)

Descrição

Descrição geral

This gene encodes a Ras GTPase activating protein that is a member of the N-methyl-D-aspartate receptor complex. The N-terminal domain of the protein contains a Ras-GAP domain, a pleckstrin homology domain, and a C2 domain that may be involved in binding of calcium and phospholipids. The C-terminal domain consists of a ten histidine repeat region, serine and tyrosine phosphorylation sites, and a T/SXV motif required for postsynaptic scaffold protein interaction. The encoded protein negatively regulates Ras, Rap and alpha-amino-3-hydroxy-5-methyl-4-isoxazolepropionic acid receptor trafficking to the postsynaptic membrane to regulate synaptic plasticity and neuronal homeostasis. Allelic variants of this gene are associated with intellectual disability and autism spectrum disorder. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Nov 2016]

Imunogênio

A synthetic peptide corresponding to a sequence within amino acids 1244-1343 of human SynGAP (Q96PV0).

PBS with 0.02% sodium azide,0.05% BSA,50% glycerol,pH7.3.

Aplicação

WB

Informações de segurança

• Código de classe de armazenamento: 10 - Combustible liquids
• Classe de risco de água (WGK): WGK 1