SAB5702151

Anti-Integrin alpha V (ITGAV/CD51) Antibody, clone 10T9N2, Rabbit Monoclonal

• Sinônimo(s): CD51,MSK8,VNRA,VTNR,Integrin alpha V,ITGAV
• Código UNSPSC: 12352203
• NACRES: NA.41

Propriedades

• fonte biológica: rabbit
• Nível de qualidade: 100
• Materiais: colorless
• clone: 10T9N2, monoclonal
• forma: liquid
• peso molecular: 140 kDa
• reatividade de espécies: rat, human, rat
• concentração: 1 mg/mL
• técnica(s): flow cytometry: 1:50 - 1:200; immunohistochemistry: 1:50 - 1:200; western blot: 1:500 - 1:2000
• cor: colorless
• Isotipo: IgG
• sequência de imunogênio: SLKSSASFNVIEFPYKNLPIEDITNSTLVTTNVTWGIQPAPMPVPVWVIILAVLAGLLLLAVLVFVMYRMGFFKRVRPPQEEQEREQLQPHENGEGNSET
• nº de adesão UniProt: P06756
• Condições de expedição: wet ice
• temperatura de armazenamento: −20°C
• modificação pós-traducional do alvo: unmodified
• Informações sobre genes: human ... ITGAV(3685)

Descrição

Descrição geral

The product of this gene belongs to the integrin alpha chain family. Integrins are heterodimeric integral membrane proteins composed of an alpha subunit and a beta subunit that function in cell surface adhesion and signaling. The encoded preproprotein is proteolytically processed to generate light and heavy chains that comprise the alpha V subunit. This subunit associates with beta 1, beta 3, beta 5, beta 6 and beta 8 subunits. The heterodimer consisting of alpha V and beta 3 subunits is also known as the vitronectin receptor. This integrin may regulate angiogenesis and cancer progression. Alternative splicing results in multiple transcript variants. Note that the integrin alpha 5 and integrin alpha V subunits are encoded by distinct genes. [provided by RefSeq, Oct 2015]

Imunogênio

A synthetic peptide corresponding to a sequence within amino acids 949-1048 of human Integrin alpha V (ITGAV/CD51) (NP_002201.2).

PBS with 0.05% proclin300,0.05% BSA,50% glycerol,pH7.3.

Aplicação

WB, IHC, FC

Informações de segurança

• Pictogramas: GHS07,GHS09
• Palavra indicadora: Warning
• Frases de perigo: H317,H411
• Declarações de precaução: P261 - P272 - P273 - P280 - P302 + P352 - P333 + P313
• Classificações de perigo: Aquatic Chronic 2 - Skin Sens. 1
• Código de classe de armazenamento: 10 - Combustible liquids
• Classe de risco de água (WGK): WGK 3