SAB2108280

Anti-PITX3 antibody produced in rabbit

affinity isolated antibody

• Código UNSPSC: 12352203
• NACRES: NA.41

Propriedades

• fonte biológica: rabbit
• Nível de qualidade: 100
• conjugado: unconjugated
• forma do anticorpo: affinity isolated antibody
• tipo de produto de anticorpo: primary antibodies
• clone: polyclonal
• Formulário: buffered aqueous solution
• peso molecular: 32kDa
• reatividade de espécies: rat, mouse, bovine, horse, dog, sheep, human, rabbit, guinea pig
• concentração: 0.5 mg - 1 mg/mL
• técnica(s): immunoblotting: suitable; immunohistochemistry: suitable
• nº de adesão NCBI: NM_005029
• nº de adesão UniProt: O75364
• Condições de expedição: wet ice
• temperatura de armazenamento: −20°C
• modificação pós-traducional do alvo: unmodified
• Informações sobre genes: human ... PITX3(5309)

Descrição

Descrição geral

The paired-like homeodomain transcription factor 3 (PITX3) is located on human chromosome 10q24. It has a characteristic homeodomain. PITX3 is a member of the RIEG/PITX homeobox family, which is in the bicoid class of homeodomain proteins.

Imunogênio

Synthetic peptide directed towards the N terminal region of human PITX3

Ações bioquímicas/fisiológicas

The paired-like homeodomain transcription factor 3 (PITX3) participates in the midbrain dopamine system development. The homeodomain of PITX3 is essential for DNA binding. Single-nucleotide polymorphism in this gene is linked with Parkinson′s disease.
Members of RIEG/PITX homeobox family act as transcription factors. Mutations of PITX3 have been associated with anterior segment mesenchymal dysgenesis (ASMD) and congenital cataracts. PITX3 is involved in lens formation during eye development. Mutations of this gene have been associated with anterior segment mesenchymal dysgenesis and congenital cataracts.

Sequência

Synthetic peptide located within the following region: MEFGLLSEAEARSPALSLSDAGTPHPQLPEHGCKGQEHSDSEKASASLPG

forma física

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Exoneração de responsabilidade

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Informações de segurança

• Código de classe de armazenamento: 10 - Combustible liquids
• Classe de risco de água (WGK): WGK 3
• Ponto de fulgor (°F): Not applicable
• Ponto de fulgor (°C): Not applicable