SAB2101530
Anti-MUC1 (ab2) antibody produced in rabbit
affinity isolated antibody
Sinônimo(s):
Anti-CD227, Anti-EMA, Anti-H23AG, Anti-MAM6, Anti-Mucin 1, cell surface associated
Faça loginpara ver os preços organizacionais e de contrato
About This Item
Código UNSPSC:
12352203
NACRES:
NA.41
Produtos recomendados
fonte biológica
rabbit
Nível de qualidade
conjugado
unconjugated
forma do anticorpo
affinity isolated antibody
tipo de produto de anticorpo
primary antibodies
clone
polyclonal
forma
buffered aqueous solution
peso molecular
14 kDa
reatividade de espécies
human
concentração
0.5 mg - 1 mg/mL
técnica(s)
immunohistochemistry: suitable
western blot: suitable
nº de adesão UniProt
Condições de expedição
wet ice
temperatura de armazenamento
−20°C
modificação pós-traducional do alvo
unmodified
Informações sobre genes
human ... MUC1(4582)
Descrição geral
The previously assigned protein identifier Q7Z550 has been merged into P15941. Full details can be found on the UniProt database.
Imunogênio
Synthetic peptide directed towards the middle region of human MUC1
Aplicação
Anti-MUC1 (ab2) antibody produced in rabbit is suitable for western blot.
Ações bioquímicas/fisiológicas
MUC1 is a membrane bound, glycosylated phosphoprotein. The protein is anchored to the apical surface of many epithelia by a transmembrane domain, with the degree of glycosylation varying with cell type. It also includes a 20 aa variable number tandem repeat (VNTR) domain, with the number of repeats varying from 20 to 120 in different individuals. The protein serves a protective function by binding to pathogens and also functions in a cell signaling capacity. Overexpression, aberrant intracellular localization, and changes in glycosylation of this protein have been associated with carcinomas. This gene is a member of the mucin family and encodes a membrane bound, glycosylated phosphoprotein. The protein is anchored to the apical surface of many epithelia by a transmembrane domain, with the degree of glycosylation varying with cell type. It also includes a 20 aa variable number tandem repeat (VNTR) domain, with the number of repeats varying from 20 to 120 in different individuals. The protein serves a protective function by binding to pathogens and also functions in a cell signaling capacity. Overexpression, aberrant intracellular localization, and changes in glycosylation of this protein have been associated with carcinomas. Multiple alternatively spliced transcript variants that encode different isoforms of this gene have been reported, but the full-length nature of only some has been determined.
Sequência
Synthetic peptide located within the following region: ASSTPGGEKETSATQRSSVPSSTEKNAFNSSLEDPSTDYYQELQRDISEM
forma física
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Exoneração de responsabilidade
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
Não está encontrando o produto certo?
Experimente o nosso Ferramenta de seleção de produtos.
Código de classe de armazenamento
10 - Combustible liquids
Classe de risco de água (WGK)
WGK 3
Ponto de fulgor (°F)
Not applicable
Ponto de fulgor (°C)
Not applicable
Certificados de análise (COA)
Busque Certificados de análise (COA) digitando o Número do Lote do produto. Os números de lote e remessa podem ser encontrados no rótulo de um produto após a palavra “Lot” ou “Batch”.
Já possui este produto?
Encontre a documentação dos produtos que você adquiriu recentemente na biblioteca de documentos.
A P Corfield et al.
Frontiers in bioscience : a journal and virtual library, 6, D1321-D1357 (2001-10-02)
Mucins form part of the dynamic, interactive mucosal defensive system active at the mucosal surface of the gastrointestinal tract. They are carbohydrate rich glycoproteins with unique molecular structure and chemical properties. The family of mucin (MUC) genes has 13 members
C J Reid et al.
Gut, 42(2), 220-226 (1998-04-16)
Mucin glycoproteins play a key role in the normal function of the epithelium lining the gastrointestinal tract. The expression of mucin genes, MUC 3, 4, 5AC, 5B, 6, 7, and 8 in human fetal tissues was examined to establish the
N Dharmaraj et al.
Human reproduction (Oxford, England), 29(8), 1730-1738 (2014-06-19)
Are the transmembrane mucins, MUC1, MUC4 and MUC16, differentially expressed in endometriosis compared with normal endometrium? This study revealed that transmembrane mucin expression does not vary significantly in normal endometrium during the menstrual cycle and is not altered in endometriosis
Yaron Niv et al.
World journal of gastroenterology, 20(40), 14913-14920 (2014-10-31)
To determine the expression of membrane-bound mucins and glycan side chain sialic acids in Helicobacter pylori (H. pylori)-associated, non-steroidal inflammatory drug (NSAID)-associated and idiopathic-gastric ulcers. We studied a cohort of randomly selected patients with H. pylori (group 1, n =
Lili Zhang et al.
The Journal of pathology, 234(1), 60-73 (2014-05-20)
Cigarette smoke increases the risk of lung cancer by 20-fold and accounts for 87% of lung cancer deaths. In the normal airway, heavily O-glycosylated mucin-1 (MUC1) and adherens junctions (AJs) establish a structural barrier that protects the airway from infectious
Nossa equipe de cientistas tem experiência em todas as áreas de pesquisa, incluindo Life Sciences, ciência de materiais, síntese química, cromatografia, química analítica e muitas outras.
Entre em contato com a assistência técnica