Pular para o conteúdo
Merck
Todas as fotos(6)

Documentos Principais

HPA004179

Sigma-Aldrich

Anti-MUC1 antibody produced in rabbit

enhanced validation

Prestige Antibodies® Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution

Sinônimo(s):

Anti-ADMCKD, Anti-ADMCKD1, Anti-CD227, Anti-MCD, Anti-MCKD, Anti-MCKD1, Anti-PEM, Anti-PUM

Faça loginpara ver os preços organizacionais e de contrato


About This Item

Número MDL:
Código UNSPSC:
12352203
Número do Atlas de Proteínas Humanas:
NACRES:
NA.41

fonte biológica

rabbit

Nível de qualidade

conjugado

unconjugated

forma do anticorpo

affinity isolated antibody

tipo de produto de anticorpo

primary antibodies

clone

polyclonal

linha de produto

Prestige Antibodies® Powered by Atlas Antibodies

Formulário

buffered aqueous glycerol solution

reatividade de espécies

human

validação aprimorada

orthogonal RNAseq
Learn more about Antibody Enhanced Validation

técnica(s)

immunohistochemistry: 1:50- 1:200

nº de adesão UniProt

aplicação(ões)

research pathology

Condições de expedição

wet ice

temperatura de armazenamento

−20°C

modificação pós-traducional do alvo

unmodified

Informações sobre genes

human ... MUC1(4582)

Descrição geral

MUC1 (Mucin 1) is O-glycosylated, carbohydrate rich, transmembrane glycoprotein. It has approximately 13 members in the family. It is localized on the apical surface of mucosal epithelia in the lung, eye, breast and stomach. It is overexpressed in several epithelial cancers, including pancreatic ductal adenocarcinoma. It is a heterodimer consisting of N-terminal (MUC1-N) and C-terminal (MUC1-C) subunits. N-terminal (MUC1-N) end contains tandem repeats (VNTR) which forms the mucin component.
Mucin 1 is encoded by the gene mapped to human chromosome 1q22.

Imunogênio

mucin 1 isoform 5 precursor recombinant protein epitope signature tag (PrEST)

Sequence
ASSTPGGEKETSATQRSSVPSSTEKNAVSMTSSVLSSHSPGSGSSTTQGQDVTLAPATEPASGSAATWGQDVTSVPVTRPALGSTTPPAHGVTS

Aplicação

Anti-MUC1 antibody produced in rabbit has been used in immunohistochemistry.

Ações bioquímicas/fisiológicas

MUC1 (Mucin 1) plays a major role in the formation of epithelium lining of the gastrointestinal tract. In gastrointestinal tract, it lubricates to protect the epithelia from oesophagus to the colon. It also lubricates the epithelia of some organs such as pancreas and gall bladder. It participates in the mucosal defensive system by functioning at the mucosal surface. It is directly involved in several signaling pathways as a modulator that affects oncogenesis, motility and metastasis.
Mutated MUC1 gene increases the risk of developing upper gastrointestinal cancers in Caucasian populations.

Características e benefícios

Prestige Antibodies® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.

Every Prestige Antibody is tested in the following ways:
  • IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
  • Protein array of 364 human recombinant protein fragments.

Ligação

Corresponding Antigen APREST86683

forma física

Solution in phosphate-buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide

Informações legais

Prestige Antibodies is a registered trademark of Merck KGaA, Darmstadt, Germany

Exoneração de responsabilidade

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Não está encontrando o produto certo?  

Experimente o nosso Ferramenta de seleção de produtos.

Código de classe de armazenamento

10 - Combustible liquids

Classe de risco de água (WGK)

WGK 1

Ponto de fulgor (°F)

Not applicable

Ponto de fulgor (°C)

Not applicable

Equipamento de proteção individual

Eyeshields, Gloves, multi-purpose combination respirator cartridge (US)


Escolha uma das versões mais recentes:

Certificados de análise (COA)

Lot/Batch Number

Não está vendo a versão correta?

Se precisar de uma versão específica, você pode procurar um certificado específico pelo número do lote ou da remessa.

Já possui este produto?

Encontre a documentação dos produtos que você adquiriu recentemente na biblioteca de documentos.

Visite a Biblioteca de Documentos

Os clientes também visualizaram

Marisa Meloni et al.
Clinical and experimental gastroenterology, 14, 361-373 (2021-09-17)
A novel experimental model based on a 3D reconstructed human oesophageal epithelium model (HO2E) has been developed to investigate the structural and functional changes of the oesophageal epithelium following exposure to a solution of HCl 0.1 N (pH = 1.2)
A P Corfield et al.
Frontiers in bioscience : a journal and virtual library, 6, D1321-D1357 (2001-10-02)
Mucins form part of the dynamic, interactive mucosal defensive system active at the mucosal surface of the gastrointestinal tract. They are carbohydrate rich glycoproteins with unique molecular structure and chemical properties. The family of mucin (MUC) genes has 13 members
C J Reid et al.
Gut, 42(2), 220-226 (1998-04-16)
Mucin glycoproteins play a key role in the normal function of the epithelium lining the gastrointestinal tract. The expression of mucin genes, MUC 3, 4, 5AC, 5B, 6, 7, and 8 in human fetal tissues was examined to establish the
N Dharmaraj et al.
Human reproduction (Oxford, England), 29(8), 1730-1738 (2014-06-19)
Are the transmembrane mucins, MUC1, MUC4 and MUC16, differentially expressed in endometriosis compared with normal endometrium? This study revealed that transmembrane mucin expression does not vary significantly in normal endometrium during the menstrual cycle and is not altered in endometriosis
Yaron Niv et al.
World journal of gastroenterology, 20(40), 14913-14920 (2014-10-31)
To determine the expression of membrane-bound mucins and glycan side chain sialic acids in Helicobacter pylori (H. pylori)-associated, non-steroidal inflammatory drug (NSAID)-associated and idiopathic-gastric ulcers. We studied a cohort of randomly selected patients with H. pylori (group 1, n =

Global Trade Item Number

SKUGTIN
HPA004179-25UL4061842721719
HPA004179-100UL4061837135187

Nossa equipe de cientistas tem experiência em todas as áreas de pesquisa, incluindo Life Sciences, ciência de materiais, síntese química, cromatografia, química analítica e muitas outras.

Entre em contato com a assistência técnica