HPA008246

Anti-MUC5B antibody produced in rabbit

Prestige Antibodies^® Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution

• Sinônimo(s): Anti-Cervical mucin, Anti-High molecular weight salivary mucin MG1, Anti-MUC-5B, Anti-Mucin-5 subtype B, tracheobronchial, Anti-Mucin-5B precursor, Anti-Sublingual gland mucin
• Código UNSPSC: 12352203
• Número do Atlas de Proteínas Humanas: HPA008246
• NACRES: NA.43

Propriedades

• fonte biológica: rabbit
• conjugado: unconjugated
• forma do anticorpo: affinity isolated antibody
• tipo de produto de anticorpo: primary antibodies
• clone: polyclonal
• linha de produto: Prestige Antibodies^® Powered by Atlas Antibodies
• forma: buffered aqueous glycerol solution
• reatividade de espécies: human
• validação aprimorada: orthogonal RNAseq; Learn more about Antibody Enhanced Validation
• técnica(s): immunofluorescence: 0.25-2 μg/mL; immunohistochemistry: 1:500-1:1000
• sequência de imunogênio: CTCTYEDRTYSYQDVIYNTTDGLGACLIAICGSNGTIIRKAVACPGTPATTPFTFTTAWVPHSTTSPALPVSTVCVREVCRWSSWYNGHRPEPGLGGGDFETFENLRQRGYQVCPVLA
• nº de adesão UniProt: Q9HC84
• Condições de expedição: wet ice
• temperatura de armazenamento: −20°C
• modificação pós-traducional do alvo: unmodified
• Informações sobre genes: human ... MUC5B(727897)

Descrição

Descrição geral

Mucin 5B (MUC5B) gene is mapped to human chromosome 11p15.5. It codes for a 3570 amino acid peptide characterized with a Cys-subdomains of 108 amino acids.

Imunogênio

Mucin-5B precursor recombinant protein epitope signature tag (PrEST)

Aplicação

All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the industry.

The Human Protein Atlas project can be subdivided into three efforts: Human Tissue Atlas, Cancer Atlas, and Human Cell Atlas. The antibodies that have been generated in support of the Tissue and Cancer Atlas projects have been tested by immunohistochemistry against hundreds of normal and disease tissues and through the recent efforts of the Human Cell Atlas project, many have been characterized by immunofluorescence to map the human proteome not only at the tissue level but now at the subcellular level. These images and the collection of this vast data set can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. We also provide Prestige Antibodies^® protocols and other useful information.

Anti-MUC5B antibody produced in rabbit has been used in immunofluorescence

Ações bioquímicas/fisiológicas

Mucin 5B (MUC5B) plays a vital role in maintaining immune homeostasis in the lungs by facilitating mucociliary clearance (MCC). Mucins are the key components that imparts gel-like properties to the mucus.(7) Mutation in the gene leads to the development of idiopathic pulmonary fibrosis. Upregulated expression of MUC5B in the ear causes middle ear effusions.

Características e benefícios

Prestige Antibodies^® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies^® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.

Every Prestige Antibody is tested in the following ways:

• IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
• Protein array of 364 human recombinant protein fragments.

Ligação

Corresponding Antigen APREST70004

forma física

Solution in phosphate-buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide

Informações legais

Prestige Antibodies is a registered trademark of Merck KGaA, Darmstadt, Germany

Exoneração de responsabilidade

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Informações de segurança

• Código de classe de armazenamento: 10 - Combustible liquids
• Classe de risco de água (WGK): WGK 1
• Equipamento de proteção individual: Eyeshields, Gloves, multi-purpose combination respirator cartridge (US)