Pular para o conteúdo
Merck
Todas as fotos(2)

Documentos Principais

SAB1402978

Sigma-Aldrich

Monoclonal Anti-MLL2 antibody produced in mouse

clone 2E1, purified immunoglobulin, buffered aqueous solution

Sinônimo(s):

AAD10, ALR, CAGL114, MLL4, TNRC21, Anti-AAD10, Anti-ALL1-related protein, Anti-ALR, Anti-CAGL114, Anti-Histone-lysine N-methyltransferase, Anti-KMS, Anti-KMT2B, Anti-KMT2D, Anti-Kabuki make-up syndrome, Anti-Kabuki mental retardation syndrome, Anti-MLL4, Anti-Myeloid/lymphoid or mixed-lineage leukemia 2, Anti-TNRC21

Faça loginpara ver os preços organizacionais e de contrato


About This Item

Código UNSPSC:
12352203
NACRES:
NA.41

fonte biológica

mouse

Nível de qualidade

conjugado

unconjugated

forma do anticorpo

purified immunoglobulin

tipo de produto de anticorpo

primary antibodies

clone

2E1, monoclonal

Formulário

buffered aqueous solution

peso molecular

antigen ~37.11 kDa

reatividade de espécies

human

técnica(s)

indirect ELISA: suitable
western blot: 1-5 μg/mL

Isotipo

IgG2aκ

nº de adesão NCBI

Condições de expedição

dry ice

temperatura de armazenamento

−20°C

modificação pós-traducional do alvo

unmodified

Informações sobre genes

human ... MLL2(8085)

Procurando produtos similares? Visita Guia de comparação de produtos

Descrição geral

Mixed-lineage leukemia 2 (MLL2), a histone methyltransferase that belongs to the trithorax group, is expressed ubiquitously in adult tissues. Structurally, MLL2 comprises plant homeodomain (PHD), Su(var)3-9, Enhancer-of-zeste and Trithorax (SET) domain, and a high mobility group (HMG) box. The MLL2 gene is mapped to human chromosome 12q13.12.

Imunogênio

MLL2 (NP_003473.1, 1487 a.a. ~ 1586 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
SKLEGMFPAYLQEAFFGKELLDLSRKALFAVGVGRPSFGLGTPKAKGDGGSERKELPTSQKGDDGPDIADEESRGLEGKADTPGPEDGGVKASPVPSDPE

Ações bioquímicas/fisiológicas

Mixed-lineage leukemia 2 (MLL2) regulates the expression of homeobox (Hox) genes. Mutations or haploinsufficiency in the MML2 gene is implicated in Kabuki syndrome, a multi-systemic disorder. It carries out methylation on the lysine 4 of histone H3 (H3K4). MLL2 plays a tumor suppressor role in Merkel cell carcinoma.

forma física

Solution in phosphate buffered saline, pH 7.4

Exoneração de responsabilidade

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Não está encontrando o produto certo?  

Experimente o nosso Ferramenta de seleção de produtos.

Código de classe de armazenamento

10 - Combustible liquids

Classe de risco de água (WGK)

WGK 1

Ponto de fulgor (°F)

Not applicable

Ponto de fulgor (°C)

Not applicable


Escolha uma das versões mais recentes:

Certificados de análise (COA)

Lot/Batch Number

Não está vendo a versão correta?

Se precisar de uma versão específica, você pode procurar um certificado específico pelo número do lote ou da remessa.

Já possui este produto?

Encontre a documentação dos produtos que você adquiriu recentemente na biblioteca de documentos.

Visite a Biblioteca de Documentos

Reety Arora et al.
Viruses, 12(9) (2020-09-04)
Merkel cell carcinoma (MCC) is an uncommon, lethal cancer of the skin caused by either Merkel cell polyomavirus (MCPyV) or UV-linked mutations. MCPyV is found integrated into MCC tumor genomes, accompanied by truncation mutations that render the MCPyV large T
Alessandra Fasciani et al.
Nature genetics, 52(12), 1397-1411 (2020-11-11)
The genetic elements required to tune gene expression are partitioned in active and repressive nuclear condensates. Chromatin compartments include transcriptional clusters whose dynamic establishment and functioning depend on multivalent interactions occurring among transcription factors, cofactors and basal transcriptional machinery. However
Young-Wook Cho et al.
The Journal of biological chemistry, 282(28), 20395-20406 (2007-05-15)
PTIP, a protein with tandem BRCT domains, has been implicated in DNA damage response. However, its normal cellular functions remain unclear. Here we show that while ectopically expressed PTIP is capable of interacting with DNA damage response proteins including 53BP1

Global Trade Item Number

SKUGTIN
SAB1402978-100UG4061831653847

Nossa equipe de cientistas tem experiência em todas as áreas de pesquisa, incluindo Life Sciences, ciência de materiais, síntese química, cromatografia, química analítica e muitas outras.

Entre em contato com a assistência técnica