Pular para o conteúdo
Merck
Todas as fotos(8)

Documentos Principais

HPA045910

Sigma-Aldrich

Anti-CRBN antibody produced in rabbit

enhanced validation

Prestige Antibodies® Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution

Sinônimo(s):

Anti-MRT2, Anti-MRT2A

Faça loginpara ver os preços organizacionais e de contrato


About This Item

Código UNSPSC:
12352203
Número do Atlas de Proteínas Humanas:
NACRES:
NA.43

fonte biológica

rabbit

conjugado

unconjugated

forma do anticorpo

affinity isolated antibody

tipo de produto de anticorpo

primary antibodies

clone

polyclonal

linha de produto

Prestige Antibodies® Powered by Atlas Antibodies

Formulário

buffered aqueous glycerol solution

reatividade de espécies

mouse, human, rat

validação aprimorada

RNAi knockdown
Learn more about Antibody Enhanced Validation

técnica(s)

immunoblotting: 0.04-0.4 μg/mL
immunofluorescence: 0.25-2 μg/mL
immunohistochemistry: 1:200-1:500

sequência de imunogênio

EVEDQDSKEAKKPNIINFDTSLPTSHTYLGADMEEFHGRTLHDDDSCQVIPVLPQVMMILIPGQTLPLQLFHPQEVSMVRNLIQKDRTFAVLAYSNVQERE

nº de adesão UniProt

Condições de expedição

wet ice

temperatura de armazenamento

−20°C

modificação pós-traducional do alvo

unmodified

Informações sobre genes

human ... CRBN(51185)

Descrição geral

The gene CRBN (cereblon) is mapped to human chromosome 3p26.2. It is strongly expressed in the brain. The encoded protein has a conserved Lon (ATP-dependent protease La) domain. The CRBN protein is present in the cytoplasm and nucleus.
CRBN protein interacts with:

Imunogênio

cereblon recombinant protein epitope signature tag (PrEST)

Aplicação

All Prestige Antibodies®Powered by Atlas Antibodies is developed and validated by the Human Protein Atlas (HPA) project . Each antibody is tested by immunohistochemistry against hundreds of normal and disease tissues. These images can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. We also provide Prestige Antibodies® protocols and other useful information.
Anti-CRBN antibody produced in rabbit has been used in western blotting.
Anti-CRBN antibody produced in rabbit has been used in immunohistochemistry

Ações bioquímicas/fisiológicas

CRBN (cereblon) mainly recruits substrates for E3 ubiquitin ligase. It interacts with BKCa (calcium-activated potassium channel subunit α-1), ClC-2 (chloride channel protein 2), AMPK (5′-AMP-activated protein kinase), PSMB4 (proteasome subunit β 4), ikaros (IKZF1), aiolos (IKZF3) and MEIS2 (Meis1-related protein). These interactions might be required for sending the proteins for ubiquitination by the E3 ubiquitin ligase. Degradation of IKZF1 (ikaros family zinc finger protein 1) and IKZF3 by lenalidomide (immunomodulatory drug)-bound CRBN helps in anti-myeloma effect of lenalidomide. Similarly, treatment with thalidomide in CRBN positive cells is effective in elderly patients with multiple myeloma. CRBN might also be associated with autosomal recessive nonsyndromic intellectual disability.

Características e benefícios

Prestige Antibodies® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.

Every Prestige Antibody is tested in the following ways:
  • IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
  • Protein array of 364 human recombinant protein fragments.

Ligação

Corresponding Antigen APREST79292

forma física

Solution in phosphate buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide.

Informações legais

Prestige Antibodies is a registered trademark of Merck KGaA, Darmstadt, Germany

Exoneração de responsabilidade

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Não está encontrando o produto certo?  

Experimente o nosso Ferramenta de seleção de produtos.

Código de classe de armazenamento

10 - Combustible liquids

Classe de risco de água (WGK)

WGK 1

Ponto de fulgor (°F)

Not applicable

Ponto de fulgor (°C)

Not applicable


Escolha uma das versões mais recentes:

Certificados de análise (COA)

Lot/Batch Number

Não está vendo a versão correta?

Se precisar de uma versão específica, você pode procurar um certificado específico pelo número do lote ou da remessa.

Já possui este produto?

Encontre a documentação dos produtos que você adquiriu recentemente na biblioteca de documentos.

Visite a Biblioteca de Documentos

Immunomodulatory drugs disrupt the cereblon-CD147-MCT1 axis to exert antitumor activity and teratogenicity.
Eichner R, et al.
Nature Medicine, 22, 735-735 (2016)
Dolores Del Prete et al.
The Journal of biological chemistry, 291(33), 17209-17227 (2016-06-22)
The amyloid precursor protein (APP), whose mutations cause Alzheimer disease, plays an important in vivo role and facilitates transmitter release. Because the APP cytosolic region (ACR) is essential for these functions, we have characterized its brain interactome. We found that
Thalidomide-based induction regimens are as effective as bortezomib-based regimens in elderly patients with multiple myeloma with cereblon expression.
Jung SH, et al.
Annals of Hematology, 95, 1645-1651 (2016)
Microduplications of 3p26.3p26.2 containing CRBN gene in patients with intellectual disability and behavior abnormalities.
Papuc SM, et al.
European Journal of Medical Genetics, 58, 319-323 (2015)
Cereblon inhibits proteasome activity by binding to the 20S core proteasome subunit beta type 4.
Lee KM, et al.
Biochemical and Biophysical Research Communications, 427, 618-618 (2012)

Nossa equipe de cientistas tem experiência em todas as áreas de pesquisa, incluindo Life Sciences, ciência de materiais, síntese química, cromatografia, química analítica e muitas outras.

Entre em contato com a assistência técnica