Pular para o conteúdo
Merck
Todas as fotos(7)

Key Documents

HPA027524

Sigma-Aldrich

Anti-ZEB1 antibody produced in rabbit

enhanced validation

Prestige Antibodies® Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution

Sinônimo(s):

Anti-AREB6, Anti-BZP, Anti-FECD6, Anti-NIL-2-A, Anti-PPCD3, Anti-TCF8, Anti-ZEB, Anti-Zfhep, Anti-Zfhx1a, Zeb1 Antibody, Zeb1 Antibody - Anti-ZEB1 antibody produced in rabbit

Faça loginpara ver os preços organizacionais e de contrato
Todas as fotos(7)

About This Item

Código UNSPSC:
12352203
Número do Atlas de Proteínas Humanas:
HPA027524
NACRES:
NA.43

fonte biológica

rabbit

conjugado

unconjugated

forma do anticorpo

affinity isolated antibody

tipo de produto de anticorpo

primary antibodies

clone

polyclonal

linha de produto

Prestige Antibodies® Powered by Atlas Antibodies

forma

buffered aqueous glycerol solution

reatividade de espécies

human

validação aprimorada

orthogonal RNAseq
Learn more about Antibody Enhanced Validation

técnica(s)

immunofluorescence: 0.25-2 μg/mL
immunohistochemistry: 1:500-1:1000

sequência de imunogênio

EAEKPESSVSSATGDGNLSPSQPPLKNLLSLLKAYYALNAQPSAEELSKIADSVNLPLDVVKKWFEKMQAGQISVQSSEPSSPEPGKVNIPAKNNDQPQSANANEPQDSTVNLQSPLKMTNSPVLPVGST

nº de adesão UniProt

P37275

Condições de expedição

wet ice

temperatura de armazenamento

−20°C

modificação pós-traducional do alvo

unmodified

Informações sobre genes

human ... ZEB1(6935)

Imunogênio

Zinc finger E-box-binding homeobox 1 recombinant protein epitope signature tag (PrEST)

Aplicação

All Prestige Antibodies®Powered by Atlas Antibodies is developed and validated by the Human Protein Atlas (HPA) project . Each antibody is tested by immunohistochemistry against hundreds of normal and disease tissues. These images can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. We also provide Prestige Antibodies® protocols and other useful information.
Anti-ZEB1 antibody produced in rabbit has been used in western blotting, chromatin immunoprecipitation, immunohistochemistry and immunofluorescence.

Ações bioquímicas/fisiológicas

ZEB1 (zinc finger E-box-binding homeobox 1) is an EMT (epithelial-mesenchymal transition) transcription factor and controls the expression of E-cadherin. It works as a repressor for E-cadherin and thereby induces EMT. Thus, ZEB1 plays an important role in tumor invasion and metastasis. Epigenetic suppression of ZEB1 might be a useful tool for overcoming drug resistance in human breast cancer. Mutations in this gene are associated with posterior polymorphous corneal dystrophy and Fuchs′ endothelial corneal dystrophy (FECD6). The ZEB1 gene is mapped to human chromosome 10p11.2.

Características e benefícios

Prestige Antibodies® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.

Every Prestige Antibody is tested in the following ways:
  • IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
  • Protein array of 364 human recombinant protein fragments.

Ligação

Corresponding Antigen APREST84772

forma física

Solution in phosphate-buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide

Informações legais

Prestige Antibodies is a registered trademark of Merck KGaA, Darmstadt, Germany

Exoneração de responsabilidade

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Não está encontrando o produto certo?  

Experimente o nosso Ferramenta de seleção de produtos.

Código de classe de armazenamento

10 - Combustible liquids

Classe de risco de água (WGK)

WGK 1

Ponto de fulgor (°F)

Not applicable

Ponto de fulgor (°C)

Not applicable

Certificados de análise (COA)

Busque Certificados de análise (COA) digitando o Número do Lote do produto. Os números de lote e remessa podem ser encontrados no rótulo de um produto após a palavra “Lot” ou “Batch”.

Já possui este produto?

Encontre a documentação dos produtos que você adquiriu recentemente na biblioteca de documentos.

Visite a Biblioteca de Documentos

Shalini Singh et al.
eLife, 5 (2016-05-15)
In the developing mammalian brain, differentiating neurons mature morphologically via neuronal polarity programs. Despite discovery of polarity pathways acting concurrently with differentiation, it's unclear how neurons traverse complex polarity transitions or how neuronal progenitors delay polarization during development. We report
Maricica Pacurari et al.
International journal of oncology, 43(2), 548-560 (2013-05-28)
Lung cancer remains the leading cause of cancer-related mortality for both men and women. Tumor recurrence and metastasis is the major cause of lung cancer treatment failure and death. The microRNA‑200 (miR-200) family is a powerful regulator of the epithelial-mesenchymal
Mutational spectrum of the ZEB1 gene in corneal dystrophies supports a genotype-phenotype correlation.
Lechner J, et al.
Investigative Ophthalmology & Visual Science, 54, 3215-3223 (2013)
Jason A Hanna et al.
BioTechniques, 52(4), 235-245 (2012-04-10)
MicroRNAs (miRNAs) have emerged as key regulators in the pathogenesis of cancers where they can act as either oncogenes or tumor suppressors. Most miRNA measurement methods require total RNA extracts which lack critical spatial information and present challenges for standardization.
A self-enforcing CD44s/ZEB1 feedback loop maintains EMT and stemness properties in cancer cells.
Preca BT, et al.
International Journal of Cancer. Journal International Du Cancer, 137, 2566-2577 (2015)
Exibir todos os documentos relacionados

Nossa equipe de cientistas tem experiência em todas as áreas de pesquisa, incluindo Life Sciences, ciência de materiais, síntese química, cromatografia, química analítica e muitas outras.

Entre em contato com a assistência técnica