Pular para o conteúdo
Merck
Todas as fotos(10)

Documentos Principais

HPA017007

Sigma-Aldrich

Anti-PADI4 antibody produced in rabbit

enhanced validation

Prestige Antibodies® Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution

Sinônimo(s):

Anti-HL-60 PAD, Anti-Peptidylarginine deiminase IV, Anti-Protein-arginine deiminase type IV, Anti-Protein-arginine deiminase type-4

Faça loginpara ver os preços organizacionais e de contrato


About This Item

Número MDL:
Código UNSPSC:
12352203
Número do Atlas de Proteínas Humanas:
NACRES:
NA.41

fonte biológica

rabbit

Nível de qualidade

conjugado

unconjugated

forma do anticorpo

affinity isolated antibody

tipo de produto de anticorpo

primary antibodies

clone

polyclonal

linha de produto

Prestige Antibodies® Powered by Atlas Antibodies

Formulário

buffered aqueous glycerol solution

reatividade de espécies

human

validação aprimorada

recombinant expression
independent
orthogonal RNAseq
Learn more about Antibody Enhanced Validation

técnica(s)

immunoblotting: 0.04-0.4 μg/mL
immunohistochemistry: 1:50-1:200

sequência de imunogênio

CEDDEVLDSEDLQDMSLMTLSTKTPKDFFTNHTLVLHVARSEMDKVRVFQATRGKLSSKCSVVLGPKWPSHYLMVPGGKHNMDFYVEALAFPDTDFPGLITLTISLLD

nº de adesão UniProt

Condições de expedição

wet ice

temperatura de armazenamento

−20°C

modificação pós-traducional do alvo

unmodified

Informações sobre genes

human ... PADI4(23569)

Descrição geral

PADI4 (peptidyl arginine deiminase, type IV) is a member of the citrullinating enzymes involved in the conversion of protein-bound arginine to citrulline.

Imunogênio

Protein-arginine deiminase type-4 recombinant protein epitope signature tag (PrEST)

Aplicação

Anti-PADI4 antibody produced in rabbit, a Prestige Antibody, is developed and validated by the Human Protein Atlas (HPA) project . Each antibody is tested by immunohistochemistry against hundreds of normal and disease tissues. These images can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. The antibodies are also tested using immunofluorescence and western blotting. To view these protocols and other useful information about Prestige Antibodies and the HPA, visit sigma.com/prestige.

Ações bioquímicas/fisiológicas

PADI4 (peptidyl arginine deiminase, type IV) is mainly involved in the Arg methylation and citrullination in histones. It binds at the histones H3 and H4 positions to convert methylated-Arg to citrulline by releasing methylamine in presence of Ca2+. It also acts as the transcriptional regulator of estrogen-responsive genes.

Características e benefícios

Prestige Antibodies® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.

Every Prestige Antibody is tested in the following ways:
  • IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
  • Protein array of 364 human recombinant protein fragments.

Ligação

Corresponding Antigen APREST70022

forma física

Solution in phosphate-buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide

Informações legais

Prestige Antibodies is a registered trademark of Merck KGaA, Darmstadt, Germany

Exoneração de responsabilidade

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Não está encontrando o produto certo?  

Experimente o nosso Ferramenta de seleção de produtos.

Código de classe de armazenamento

10 - Combustible liquids

Classe de risco de água (WGK)

WGK 1

Ponto de fulgor (°F)

Not applicable

Ponto de fulgor (°C)

Not applicable

Equipamento de proteção individual

Eyeshields, Gloves, multi-purpose combination respirator cartridge (US)


Escolha uma das versões mais recentes:

Certificados de análise (COA)

Lot/Batch Number

Não está vendo a versão correta?

Se precisar de uma versão específica, você pode procurar um certificado específico pelo número do lote ou da remessa.

Já possui este produto?

Encontre a documentação dos produtos que você adquiriu recentemente na biblioteca de documentos.

Visite a Biblioteca de Documentos

Zsuzsanna Baka et al.
International immunology, 23(6), 405-414 (2011-05-24)
Anti-citrullinated protein antibodies (ACPAs), produced against citrullinated proteins, are diagnostic and prognostic markers of rheumatoid arthritis (RA). The underlying mechanism that explains the connection of smoking, citrullination [catalyzed by peptidyl arginine deiminases (PADs)] and ACPAs is still unclarified in RA.
Yanming Wang et al.
Science (New York, N.Y.), 306(5694), 279-283 (2004-09-04)
Methylation of arginine (Arg) and lysine residues in histones has been correlated with epigenetic forms of gene regulation. Although histone methyltransferases are known, enzymes that demethylate histones have not been identified. Here, we demonstrate that human peptidylarginine deiminase 4 (PAD4)
Erik R Vossenaar et al.
BioEssays : news and reviews in molecular, cellular and developmental biology, 25(11), 1106-1118 (2003-10-28)
Peptidylarginine deiminase (PAD, EC 3.5.3.15) enzymes catalyze the conversion of protein-bound arginine to citrulline. This post-translational modification may have a big impact on the structure and function of the target protein. In this review, we will discuss the effects of

Global Trade Item Number

SKUGTIN
HPA017007-100UL4061837137815

Nossa equipe de cientistas tem experiência em todas as áreas de pesquisa, incluindo Life Sciences, ciência de materiais, síntese química, cromatografia, química analítica e muitas outras.

Entre em contato com a assistência técnica