HPA015267

Anti-CDK14 antibody produced in rabbit

Prestige Antibodies^® Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution

• Sinônimo(s): Anti-PFTK1, Anti-Serine/threonine-protein kinase PFTAIRE-1
• Código UNSPSC: 12352203
• Número do Atlas de Proteínas Humanas: HPA015267
• NACRES: NA.43

Propriedades

• fonte biológica: rabbit
• Nível de qualidade: 100
• conjugado: unconjugated
• forma do anticorpo: affinity isolated antibody
• tipo de produto de anticorpo: primary antibodies
• clone: polyclonal
• linha de produto: Prestige Antibodies^® Powered by Atlas Antibodies
• Formulário: buffered aqueous glycerol solution
• reatividade de espécies: human
• técnica(s): immunofluorescence: 0.25-2 μg/mL; immunohistochemistry: 1:20-1:50
• sequência de imunogênio: DDTTFDEICVTKMSTRNCQGMDSVIKPLDTIPEDKKVRVQRTQSTFDPFEKPANQVKRVHSENNACINFKTSSTGKESPKVRRHSSPSSPTSPKFGKADSYEKLEKLGEGSYATVYKGKSKVNG
• Condições de expedição: wet ice
• temperatura de armazenamento: −20°C
• modificação pós-traducional do alvo: unmodified
• Informações sobre genes: human ... PFTK1(5218)

Descrição

Descrição geral

CDK14 (cyclin-dependent kinase 14) belongs to a 21 member cyclin dependent kinase gene family. It is also called PFTK1 or PFTAIRE1. This family contains two groups- 10 classical CDKs and the rest 11 are members of a new group. This gene is localized to human chromosome 7q21.13, and has a high expression level in brain, heart, pancreas, kidney, ovaries and testis. In lungs, it is expressed in bronchial and alveolar epithelium.

Imunogênio

Serine/threonine-protein kinase PFTAIRE-1 recombinant protein epitope signature tag (PrEST)

Aplicação

Anti-CDK14 antibody produced in rabbit, a Prestige Antibody, is developed and validated by the Human Protein Atlas (HPA) project . Each antibody is tested by immunohistochemistry against hundreds of normal and disease tissues. These images can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. The antibodies are also tested using immunofluorescence and western blotting. To view these protocols and other useful information about Prestige Antibodies and the HPA, visit sigma.com/prestige.

Applications in which this antibody has been used successfully, and the associated peer-reviewed papers, are given below.
Immunohistochemistry (1 paper)

Ações bioquímicas/fisiológicas

CDK14 (cyclin-dependent kinase 14) facilitates cell division, and also has functions as an oncogene. In hepatocellular carcinoma, it aids in tumor growth and metastasis. It is overexpressed in esophageal squamous cell carcinoma (ESCC), and this is related to poor response to chemotherapy. It has potential as a marker for prognosis as well as response to chemotherapy in ESCC. Studies in mice show that cigarette smoke leads to reduced expression of this protein in both testicular and lung cells. In lungs, this results in decreased β-catenin, resulting in aberrant Wnt signaling. Studies in mice also show that this protein is involved in meiosis and differentiation of neuronal cells. It phosphorylates caldesmon, an actin-binding protein, and thus facilitates the binding of actin molecules, and the formation of stress fibers.

Características e benefícios

Prestige Antibodies^® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies^® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.

Every Prestige Antibody is tested in the following ways:

• IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
• Protein array of 364 human recombinant protein fragments.

Ligação

Corresponding Antigen APREST73464

forma física

Solution in phosphate-buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide

Informações legais

Prestige Antibodies is a registered trademark of Merck KGaA, Darmstadt, Germany

Exoneração de responsabilidade

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Informações de segurança

• Código de classe de armazenamento: 10 - Combustible liquids
• Classe de risco de água (WGK): WGK 1
• Ponto de fulgor (°F): Not applicable
• Ponto de fulgor (°C): Not applicable
• Equipamento de proteção individual: Eyeshields, Gloves, multi-purpose combination respirator cartridge (US)