Pular para o conteúdo
Merck
Todas as fotos(4)

Documentos Principais

HPA005437

Sigma-Aldrich

Anti-BIN1 antibody produced in rabbit

enhanced validation

Ab1, Prestige Antibodies® Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution

Sinônimo(s):

Anti-Amphiphysin II antibody produced in rabbit, Anti-Amphiphysin-like protein antibody produced in rabbit, Anti-Box-dependent myc-interacting protein 1 antibody produced in rabbit, Anti-Bridging integrator 1 antibody produced in rabbit, Anti-Myc box-dependent-interacting protein 1 antibody produced in rabbit

Faça loginpara ver os preços organizacionais e de contrato


About This Item

Número MDL:
Código UNSPSC:
12352203
Número do Atlas de Proteínas Humanas:
NACRES:
NA.41

fonte biológica

rabbit

conjugado

unconjugated

forma do anticorpo

affinity isolated antibody

tipo de produto de anticorpo

primary antibodies

clone

polyclonal

linha de produto

Prestige Antibodies® Powered by Atlas Antibodies

Formulário

buffered aqueous glycerol solution

reatividade de espécies

human

validação aprimorada

orthogonal RNAseq
Learn more about Antibody Enhanced Validation

técnica(s)

immunohistochemistry: 1:50-1:200

sequência de imunogênio

VTAGKIASNVQKKLTRAQEKVLQKLGKADETKDEQFEQCVQNFNKQLTEGTRLQKDLRTYLASVKAMHEASKKLNECLQEVYEPDWPGRDEANKIAENNDLLWMDYHQKLVDQALLTMDTYLGQFPDIKSRIAKRGRKLVDYDSARHH

nº de adesão UniProt

Condições de expedição

wet ice

temperatura de armazenamento

−20°C

modificação pós-traducional do alvo

unmodified

Informações sobre genes

human ... BIN1(274)

Procurando produtos similares? Visita Guia de comparação de produtos

Descrição geral

Bridging integrator-1 (BIN1), also called amphiphysin II, is a nucleocytoplasmic protein which is ubiquitously expressed. It is a ligand to the transcription factor Myc and also interacts with SRC SH3, which is a tyrosine kinase ligand. Amphiphysin II is a member of the amphiphysin family, along with amphiphysin I. Depending upon the cell type, human BIN1 gene is alternatively spliced. In humans, BIN1 gene is located on chromosome 2q14 and has 20 exons. Gene splicing leads to various isoforms, of which isoform 8 is found in skeletal muscles, 1 to 7 in brain and 9 and 10 are expressed ubiquitously. It is also called SH3P9, and has an N-BAR (Bin-amphiphysin/Rvs) domain, a phosphoinositide (PI) binding motif, clathrin and AP2 (CLAP) binding domain, Myc-binding domain (MBD) as well as SRC homology 3 domain.

Imunogênio

Myc box-dependent-interacting protein 1 recombinant protein epitope signature tag (PrEST)

Aplicação

All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the industry.

The Human Protein Atlas project can be subdivided into three efforts: Human Tissue Atlas, Cancer Atlas, and Human Cell Atlas. The antibodies that have been generated in support of the Tissue and Cancer Atlas projects have been tested by immunohistochemistry against hundreds of normal and disease tissues and through the recent efforts of the Human Cell Atlas project, many have been characterized by immunofluorescence to map the human proteome not only at the tissue level but now at the subcellular level. These images and the collection of this vast data set can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. We also provide Prestige Antibodies® protocols and other useful information.

Ações bioquímicas/fisiológicas

The N-terminal BAR domain of Bridging integrator-1 (BIN1) is responsible for the regulation of membrane curvature sensing and generation (MC-S&G). This function of BIN1, in turn is regulated and auto-inhibited by the PI binding motif and the SH3 domain, which recruit downstream proteins such as dynamin-2. It interacts with Myc oncoproteins and acts as a tumor suppressor gene, and therefore, its expression is reduced in cancer cells. BIN1 also mediates endocytosis in brain by binding to AP2 and clathrin, which are endocytic proteins. BIN1 mediates endocytosis, cell migration, and endosomal sorting through membrane remodeling. This is achieved via its N-BAR domain, which mediates the formation of plasma membrane invaginations (T-tubules) in muscles. Centronuclear myopathy (CNM) has been linked to 3 mutations in the N-BAR gene, namely, K35N, D151N and R154Q. It has also been linked to late-onset Alzheimer′s disease and heart failure.

Características e benefícios

Prestige Antibodies® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.

Every Prestige Antibody is tested in the following ways:
  • IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
  • Protein array of 364 human recombinant protein fragments.

Ligação

Corresponding Antigen APREST70745

forma física

Solution in phosphate-buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide

Informações legais

Prestige Antibodies is a registered trademark of Merck KGaA, Darmstadt, Germany

Não está encontrando o produto certo?  

Experimente o nosso Ferramenta de seleção de produtos.

Código de classe de armazenamento

10 - Combustible liquids

Classe de risco de água (WGK)

WGK 1

Ponto de fulgor (°F)

Not applicable

Ponto de fulgor (°C)

Not applicable

Equipamento de proteção individual

Eyeshields, Gloves, multi-purpose combination respirator cartridge (US)


Escolha uma das versões mais recentes:

Certificados de análise (COA)

Lot/Batch Number

Não está vendo a versão correta?

Se precisar de uma versão específica, você pode procurar um certificado específico pelo número do lote ou da remessa.

Já possui este produto?

Encontre a documentação dos produtos que você adquiriu recentemente na biblioteca de documentos.

Visite a Biblioteca de Documentos

Ivana Prokic et al.
Journal of molecular medicine (Berlin, Germany), 92(5), 453-463 (2014-03-05)
Amphiphysin 2, also named bridging integrator-1 (BIN1) or SH3P9, has been recently implicated in rare and common diseases affecting different tissues and physiological functions. BIN1 downregulation is linked to cancer progression and also correlates with ventricular cardiomyopathy and arrhythmia preceding
Tingting Wu et al.
PloS one, 9(4), e93060-e93060 (2014-04-24)
The regulation of membrane shapes is central to many cellular phenomena. Bin/Amphiphysin/Rvs (BAR) domain-containing proteins are key players for membrane remodeling during endocytosis, cell migration, and endosomal sorting. BIN1, which contains an N-BAR domain, is assumed to be essential for
Tingting Wu et al.
Biochemistry, 53(46), 7297-7309 (2014-10-29)
In striated muscles, invaginations from the plasma membrane, termed transverse tubules (T-tubule), function in the excitation-contraction coupling machinery. BIN1 (isoform8) plays a critical role in the biogenesis of T-tubules. BIN1 contains an N-terminal BAR domain to sense and induce membrane

Nossa equipe de cientistas tem experiência em todas as áreas de pesquisa, incluindo Life Sciences, ciência de materiais, síntese química, cromatografia, química analítica e muitas outras.

Entre em contato com a assistência técnica