Pular para o conteúdo
Merck
Todas as fotos(2)

Documentos Principais

HPA001815

Sigma-Aldrich

Anti-VWF antibody produced in rabbit

Ab1, Prestige Antibodies® Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution

Sinônimo(s):

Anti-vWF antibody produced in rabbit, Anti-von Willebrand factor precursor antibody produced in rabbit

Faça loginpara ver os preços organizacionais e de contrato


About This Item

Número MDL:
Código UNSPSC:
12352203
Número do Atlas de Proteínas Humanas:
NACRES:
NA.41

fonte biológica

rabbit

Nível de qualidade

conjugado

unconjugated

forma do anticorpo

affinity isolated antibody

tipo de produto de anticorpo

primary antibodies

clone

polyclonal

linha de produto

Prestige Antibodies® Powered by Atlas Antibodies

Formulário

buffered aqueous glycerol solution

reatividade de espécies

human

técnica(s)

immunohistochemistry: 1:50- 1:200

sequência de imunogênio

ARSNRVTVFPIGIGDRYDAAQLRILAGPAGDSNVVKLQRIEDLPTMVTLGNSFLHKLCSGFVRICMDEDGNEKRPGDVWTLPDQCHTVTCQPDGQTLLKSHRVNCDRGLRPSCPNSQSPVKVEKT

nº de adesão UniProt

Condições de expedição

wet ice

temperatura de armazenamento

−20°C

modificação pós-traducional do alvo

unmodified

Informações sobre genes

human ... VWF(7450)

Procurando produtos similares? Visita Guia de comparação de produtos

Imunogênio

von Willebrand factor precursor recombinant protein epitope signature tag (PrEST)

Aplicação

Anti-VWF antibody produced in rabbit, a Prestige Antibody, is developed and validated by the Human Protein Atlas (HPA) project . Each antibody is tested by immunohistochemistry against hundreds of normal and disease tissues. These images can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. The antibodies are also tested using immunofluorescence and western blotting. To view these protocols and other useful information about Prestige Antibodies and the HPA, visit sigma.com/prestige.

Ações bioquímicas/fisiológicas

Von Willebrand factor (VWF) is a large, adhesive glycoprotein synthesized only by endothelial cells and megakaryocytes, a platelet precursor. It is stored in α-granules in megakaryocytes or Weibel-Palade bodies in endothelial cells. In immature state, it is called as pre-pro-VWF molecule. It consists of D1 and D2 domains which are essential for multimerization. Upon maturation, it develops two other domains. During maturation the signal peptide of pro-VWF is cleaved to form C-terminal dimers in endoplasmic reticulum. The dimers are subjected to further modifications such as carbohydrate processing, sulfation and amino-terminal multimerization. The mature VWF plays major role in hemostasis. Firstly, it helps in attaching platelets through the glycoprotein Ib receptor to subendothelial tissue at the site of vascular injury. It also act as carrier protein for protecting coagulation factor VIII from proteolytic degradation by plasma enzymes. Deficiency or any alteration in VWF results in von Willebrand disease, a common hereditary bleeding disorder.

Características e benefícios

Prestige Antibodies® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.

Every Prestige Antibody is tested in the following ways:
  • IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
  • Protein array of 364 human recombinant protein fragments.

Ligação

Corresponding Antigen APREST83058

forma física

Solution in phosphate-buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide

Informações legais

Prestige Antibodies is a registered trademark of Merck KGaA, Darmstadt, Germany

Exoneração de responsabilidade

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Não está encontrando o produto certo?  

Experimente o nosso Ferramenta de seleção de produtos.

Código de classe de armazenamento

10 - Combustible liquids

Classe de risco de água (WGK)

WGK 1

Ponto de fulgor (°F)

Not applicable

Ponto de fulgor (°C)

Not applicable

Equipamento de proteção individual

Eyeshields, Gloves, multi-purpose combination respirator cartridge (US)


Escolha uma das versões mais recentes:

Certificados de análise (COA)

Lot/Batch Number

Não está vendo a versão correta?

Se precisar de uma versão específica, você pode procurar um certificado específico pelo número do lote ou da remessa.

Já possui este produto?

Encontre a documentação dos produtos que você adquiriu recentemente na biblioteca de documentos.

Visite a Biblioteca de Documentos

Os clientes também visualizaram

Dinender K Singla et al.
Journal of molecular and cellular cardiology, 40(1), 195-200 (2005-11-18)
Initial studies have suggested that transplantation of embryonic stem (ES) cells following myocardial infarction (MI) in animal models is beneficial; however, the mechanism of benefit is largely unknown. The present study investigated the fate of mouse ES cells transplanted post-MI
Feng Hao et al.
American journal of physiology. Cell physiology, 311(6), C975-C984 (2016-10-21)
Vascular smooth muscle cell (SMC) migration is an essential step involved in neointimal formation in restenosis and atherosclerosis. Lysophosphatidic acid (LPA) is a bioactive component of oxidized low-density lipoprotein and is produced by activated platelets, implying that LPA influences vascular
Yang Xu et al.
Arteriosclerosis, thrombosis, and vascular biology, 24(3), 477-482 (2004-01-24)
Arterial injury results in vascular remodeling associated with proliferation and migration of smooth muscle cells (SMCs) and the development of intimal hyperplasia, which is a critical component of restenosis after angioplasty of human coronary arteries and an important feature of
Cell biology of von Willebrand factor.
D D Wagner
Annual review of cell biology, 6, 217-246 (1990-01-01)
P C Lee et al.
The American journal of physiology, 277(4 Pt 2), H1600-H1608 (1999-10-12)
A role for nitric oxide (NO) in wound healing has been proposed; however, the absolute requirement of NO for wound healing in vivo and the contribution of endothelial NO synthase (eNOS) have not been determined. Experiments were carried out using

Global Trade Item Number

SKUGTIN
HPA001815-100UL4061837133213
HPA001815-25UL4061842779994

Nossa equipe de cientistas tem experiência em todas as áreas de pesquisa, incluindo Life Sciences, ciência de materiais, síntese química, cromatografia, química analítica e muitas outras.

Entre em contato com a assistência técnica